KEGG   Canis familiaris (dog): 488898
Entry
488898            CDS       T01007                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cfa01002]
    488898 (ERAP1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     488898 (ERAP1)
Peptidases and inhibitors [BR:cfa01002]
 Metallo peptidases
  Family M1
   488898 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 488898
NCBI-ProteinID: XP_005618142
Ensembl: ENSCAFG00000007810
VGNC: 40433
UniProt: E2R302
Position
3
AA seq 942 aa
MISPSVTWPLATMPFLSSSLLLLLTVSTPSWCQSSDTTSPKATNGTPFPWDKIRLPEHIV
PVHYDLMIHANLTTLTFEGTTEIEIAASRPTSAIILHSHLLQVSKATLRRRVGERLTAEP
LRVLEYPPHEQIALVASEPLVVGLPYTVVIDYTGHLSGHLNGFYKSTYRTKEGEVRVLAS
THFEPTAARMAFPCFDEPAFKANFSVKIRREPRHVAISNMPLVKSVTVAEGLLEDHFDVT
VKMSTYLVAFIISDFESISKMTKNGVKVSIYAVPDKIHQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFESGAMENWGLTTYRESALLFDAEKSSASDKLGITLIVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFDVMEVDALNSSHPV
STAVEDPAQIREMFDEVSYEKGACILNMLRDYLGADAFKSGIVQYLLKHSYKNTKNEDLW
NSMASICPTGGTERMDGFCSRGSRSSSSSHWQQEGLDVKTMMNTWTLQKGFPLVTVTVRG
RNVHMKQELYRKGPDDASETGDLWHVPLTFITSKSDSVQRFLLKTKTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTALLKGAHTTISSNDRASLINNAFQLVSNGKLSVEKALD
LTLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVENQFKAFLIRLLRDLIDNQTWTDE
GSVTERMLRSQLLLLACVRKYPPCVQRAEAYFREWKESDGNLSLPSDVTLAVFAVGVQNP
EGWDFLYRKYQSSLSNTEKNNIEVALCVSQDEEKLQWLLDESFKGDVIKLQEFPHILRTV
GRNPVGYPLAWKFLRENWDKLIQKFELGSSSLTSMVIGTTNQFSTRARLEEVKEFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQSQKLELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatatctccgtccgtcacatggccacttgcaaccatgccatttctatcgtcctcactc
ttgcttctcttaactgtgtcaactccttcctggtgtcagagcagtgacactacgtctccg
aaagctaccaatgggacaccattcccttgggataaaatacgacttcctgagcacattgtc
ccagttcattacgatctcatgatccacgcaaatctcaccactctgactttcgagggaacc
acggaaatagaaatcgcagccagccggcctacaagtgccatcatcctgcacagtcacctt
ctgcaagtatctaaggccaccctcaggaggagagttggagagaggctgactgcagaaccc
ttgagagtcctggaatacccgcctcacgagcaaatcgcacttgtggcttccgagcctctg
gtggttgggctcccgtacacagttgtcattgactacactggccatctctcggggcattta
aatggattttataaaagcacctacagaaccaaggaaggggaagtgagagtacttgcatca
acacactttgaacctactgcggccagaatggcctttccctgctttgatgaacctgccttc
aaagcgaatttttcagtcaagatccgaagggagcccagacacgtcgccatctccaatatg
ccgctggttaaatctgtgactgttgctgaaggactcctagaagaccattttgatgtcact
gtgaagatgagcacctacctggtggccttcattatttcagattttgagtccattagcaag
atgaccaagaacggagtcaaggtttccatatatgctgtgccagacaagatacaccaggca
gattatgccctggatgccgccgtgacgcttctagaattttatgaggattatttcagcatt
ccatatcccttgcccaaacaagatcttgctgctattccggactttgagagtggtgctatg
gaaaactggggactgaccacgtacagagaatctgctctgttgtttgatgctgagaagtct
tctgcgtcagataagcttggcattactttgatagtgtctcatgaactcgcccaccagtgg
tttggaaacctcgttaccatggaatggtggaatgatctttggttaaatgagggctttgcc
aagtttatggagtttgtgtctgtcagtgtgactcatcctgaactgaaagttgaagattat
ttctttggcaagtgttttgatgtgatggaggtagatgcattaaattcttcacaccctgtg
tcgacagctgtggaggatcctgctcagattcgggagatgtttgatgaggtttcttatgaa
aagggagcttgtattctgaatatgctaagggattatcttggtgccgatgcatttaaaagt
ggcattgtccagtatctcctgaagcatagctacaaaaacacaaaaaatgaggacctgtgg
aacagcatggcaagtatttgcccaacaggtggcacagagaggatggatggcttttgctct
aggggctcacgttcatcttcatcgtcacactggcaacaggaaggccttgatgtaaaaacc
atgatgaacacgtggacgctgcagaaaggctttcccctggtaaccgtcacagtgagaggg
aggaacgtacacatgaagcaggagctctacaggaagggacctgatgacgcctcagaaact
ggggacctgtggcatgttccattgaccttcattaccagcaaatcggactcagtccaaaga
tttttgctgaagacaaaaacagatgtgctcatcctccccgaagaggtagaatggatcaaa
tttaatgttggaatgaatggctattacattgtgcattatgaggatgatggatgggattct
ttgaccgctcttttaaaaggggcgcacacgacaatcagcagcaatgaccgggccagtctc
attaacaatgcatttcagcttgtcagcaatggaaaactctcagttgaaaaagccttggat
ttaaccctgtacttgaaacatgaaacggaaattatgccggtgttccagggtttgaacgag
ctgatccctatgtataagttgatggagaaaagagatatgaatgaagtggaaaatcagttc
aaggcctttctcatcaggctgctgagggacctcattgataatcagacgtggacagatgag
ggctcagtgacggagcgaatgctgcggagccagctcctcctcctcgcctgtgtgcgcaag
tatccgccctgtgtgcagagggcagaagcctatttcagagagtggaaggaatccgatgga
aatttgagccttcccagcgatgtgaccttggcagtgtttgctgttggggtccagaacccg
gaaggatgggattttctttatagaaaatatcagtcttctttgtctaatactgagaaaaat
aacattgaagttgccctctgtgttagccaagatgaggaaaagcttcagtggctactagat
gaaagttttaagggagacgtaataaaacttcaagagtttccacatattcttagaactgtt
ggcaggaacccggtgggatatccattggcctggaagtttctgagggaaaattgggataaa
cttatacaaaagtttgaacttggctcatcttccctaacctctatggtaataggaacaaca
aatcagttctccacaagagcacggcttgaggaggtgaaagaattcttcagctctttgaag
gaaaatggttctcagctacgttgtgtccagcaaacaattgaaaccattgaggaaaacata
cgttggatggataagaattttgataagatcagagtgtggctacaaagccagaagcttgaa
ctgctctaa

DBGET integrated database retrieval system