KEGG   Canis lupus familiaris (dog): 489020
Entry
489020            CDS       T01007                                 

Gene name
TACR2
Definition
(RefSeq) substance-K receptor
  KO
K04223  tachykinin receptor 2
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04020  Calcium signaling pathway
cfa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    489020 (TACR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    489020 (TACR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cfa04030]
    489020 (TACR2)
G protein-coupled receptors [BR:cfa04030]
 Rhodopsin family
  Peptide
   Tachykinin
    489020 (TACR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 489020
NCBI-ProteinID: NP_001012635
Ensembl: ENSCAFG00000013952
VGNC: 47067
UniProt: Q5DUB2
Position
4
AA seq 384 aa
MGAHAIVTDANISSSLENNTTGITAFSMPGWQLALWATAYLVLVLVAVTGNATVIWIILA
HQRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCHFQNLFPITAMFVS
IYSMTAIAADRYVAIVHPFQPRLSAPGTRAVIAGIWLLALALAFPQCFYSTITMDQGATK
CVVVWPEDNGSKMLLLYHLVVIALIYVLPLLVMLLAYSVIGLTLWRREVPRHQVHGASLR
HLRAKKKFVKTMVLVVVTFAICWLPYHFYFILGSFQEDIYYHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDKIELTHTPSLSARINRCHTKETFFMA
GETALSPATNGQARGPQDGLPDEP
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgggggcccatgccattgtgactgacgccaacatctcgtccagccttgagaacaacacc
acaggcatcacggccttctccatgcccggctggcagctggcactgtgggccaccgcctac
ctggtcctggtgttggtggccgtgacgggcaatgccacggtcatctggatcatcctggcc
catcaaagaatgcgcacagtcaccaattacttcatcgtcaacctggccctggctgacctc
tgcatggccgccttcaacgctgccttcaatttcgtctacgccagccacaacatctggtac
tttggccgtgccttctgtcatttccagaacctcttccccatcacagccatgttcgtcagc
atctactccatgaccgccatcgccgctgacaggtacgtggccatcgtccaccccttccag
ccccggctctctgccccaggcaccagagcggtgattgctggcatctggctgctggccctg
gccctcgccttcccccagtgcttctactccaccatcaccatggaccagggcgccaccaag
tgtgtggtggtgtggcctgaggacaacggcagcaagatgctccttttgtaccacctggtg
gtgatcgccctcatctacgtgctgcctctcttggtgatgctcctcgcctacagtgtcatc
ggcctcactctctggagacgcgaggttcccaggcaccaggtgcacggcgccagcctgcgc
cacctgcgagccaagaagaagtttgtgaagaccatggtgctggtggtggtgacatttgcc
atctgctggctgccctaccacttctacttcatcctgggcagcttccaggaggacatctac
taccacaagttcatccagcaggtgtacttggcgctcttctggctggccatgagctccaca
atgtacaatcccatcatctactgctgcctcaaccacaggtttcgctctggattccggctt
gctttccgttgctgcccgtgggtcacgccaactgaggaggataagattgagctgactcac
actccatccctctctgcgaggatcaacaggtgccacactaaagagactttcttcatggct
ggggagactgccctttctccggctaccaatgggcaggccaggggtccccaagatgggtta
cctgatgaaccctga

DBGET integrated database retrieval system