KEGG   Canis familiaris (dog): 489039Help
Entry
489039            CDS       T01007                                 

Gene name
DNAJB12
Definition
(RefSeq) dnaJ homolog subfamily B member 12
  KO
K09518  DnaJ homolog subfamily B member 12
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    489039 (DNAJB12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cfa03110]
    489039 (DNAJB12)
Chaperones and folding catalysts [BR:cfa03110]
 Heat shock proteins
  HSP40 / DNAJ
   489039 (DNAJB12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1977 DnaJ TPR_2 TPR_1 TPR_19
Motif
Other DBs
NCBI-GeneID: 489039
NCBI-ProteinID: XP_005619055
Ensembl: ENSCAFG00000014441
UniProt: E2RGJ6
Position
4
AA seq 373 aa AA seqDB search
MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYPTPRVRALIESLNQKPQSASDR
PSPTDTTHRKAGGTDAPSANGEAGGGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGAS
DEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAAR
HGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRENQGDG
GLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHVHRRITDHLNVVYYVADSFS
KEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHKAQRMGTPS
CSRLSEVQASLHG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggaatccaacaaggatgaagccgagcgctgtattagcatcgccctcaaggccatccag
agcaaccagcccgaccgggcgctccgcttcctggagaaggcgcagcggctgtacccgacg
ccgcgagtccgcgccctgatcgagtccctcaaccagaagccacagtctgccagtgaccgt
ccctcacccacagacacgacccacaggaaagctggtgggaccgacgccccctcggccaac
ggagaagctggaggaggagagagcaccaaaggctacaccgcagagcaagtagcagcagtg
aaaagggtcaagcagtgtaaagattactatgagatcctgggggtgagcagaggagcctcc
gacgaggacctgaagaaggcctaccgcaagctggccctcaagttccacccggacaagaac
cacgcgcccggggccactgaggctttcaaagccattggcacagcatatgcagtacttagt
aacccagagaaaaggaagcaatatgaccagtttggtgatgacaagagccaggcagcccga
catggccatggacatggggacttccaccgtggctttgaggctgacatctccccggaggac
ctcttcaacatgttctttggcggtggcttcccgtctagtaacgtccacgtctacagcaac
ggccgcatgcgctatacctaccagcaaaggcaggaccgcagggagaaccagggtgacggc
gggctgggggtgtttgttcagctgatgcccatcctcatcctgatcctcgtgtcggctctc
agccagctcatggtctccagccccccgtacagcctgagcccaaggccgtcagtgggccat
gtccacaggcggatcactgaccacctgaatgtcgtctactacgtggcagacagcttctct
aaggagtacacaggctccagcctcaaaacagttgaacggaacgtggaagacgattatatc
gccaacctccgaaacaactgctggaaggagaagcagcaaaaggaaggcttgctgtaccgg
gcccgctacttcggtgacacagatatgtaccacaaagcacagcggatgggcaccccgagc
tgtagccgactgtcagaggtgcaggcctccctgcatggatag

DBGET integrated database retrieval system