KEGG   Canis lupus familiaris (dog): 489093
Entry
489093            CDS       T01007                                 

Symbol
MXD3
Name
(RefSeq) max dimerization protein 3 isoform X1
  KO
K09114  MAX dimerization protein
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    489093 (MXD3)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    489093 (MXD3)
SSDB
Motif
Pfam: HLH EcoEI_R_C
Other DBs
NCBI-GeneID: 489093
NCBI-ProteinID: XP_022273369
Ensembl: ENSCAFG00000016437
VGNC: 51904
Position
4
AA seq 281 aa
MEPVASNIQVLLQAAEFLERREREAEHGYASLYPHRSPGPVYRRRKRSPQASGALDSGRK
PFLWTPQPPEQASQHLAPACLCLCLRTPVLKVCAQRAGETQVSRSFALTALGPGTNPLWP
FLPLLSLWPARLGWHCPPDPSSHRRAQLKRCLEQLKQQMPLGADCARSTTLSLLRWARVH
IQKLEEQEQQARRLKEKLRSKQQSLQRQLEWLRGLAGPGERERPRADSLDSSGLSSERSD
SDQEEVEVDVESLVFGGEAELLRGFSAGQEHSYSHSSSTWL
NT seq 846 nt   +upstreamnt  +downstreamnt
atggaacccgtggccagcaatatccaggtgctgctgcaggcggccgagttcctagagcgc
cgcgagagagaagccgagcacggctacgcgtccctgtacccgcaccgcagtccaggccca
gtctaccggaggaggaagcgatcgccccaagcttctggcgcgctggacagtgggcggaag
cccttcctttggaccccacaaccaccagagcaggcctcccagcatttggccccagcatgt
ctctgcctctgcctgcggaccccagtgctcaaggtctgtgcacaacgagctggagaaacg
caggtgagtcgtagctttgccctgacagcactgggcccaggaaccaaccctctatggcct
ttcctccccctgctgtccctctggcctgccaggctgggctggcactgccctccagatccc
tcctcccacaggagggcccagctgaagcggtgcctggagcagctaaaacaacagatgccg
ttgggggctgactgtgcccgctctaccacactgagccttctgcgctgggccagggtgcat
atccagaagctggaggagcaggagcagcaggcgcggcggctcaaggagaagctgcgtagc
aagcagcagagcctgcagcggcagctggagtggctccgggggctggcagggccgggtgag
agggagcggccgcgggcagacagcctggactcttcaggcctctcctccgagcgctcagac
tcagaccaagaggaggtggaggtggacgtggagagcctggtgttcgggggcgaggctgag
ctgctgcgcggcttcagtgcgggccaggagcacagctactcacacagcagcagcacctgg
ctatga

DBGET integrated database retrieval system