KEGG   Canis lupus familiaris (dog): 489128
Entry
489128            CDS       T01007                                 

Gene name
DOCK2
Definition
(RefSeq) dedicator of cytokinesis protein 2
  KO
K12367  dedicator of cytokinesis protein 2
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    489128 (DOCK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    489128 (DOCK2)
Membrane trafficking [BR:cfa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    489128 (DOCK2)
SSDB
Motif
Pfam: DOCK_N DHR-2 DOCK-C2 SH3_2 SH3_1 SH3_9 DUF1539
Other DBs
NCBI-GeneID: 489128
NCBI-ProteinID: XP_546246
Ensembl: ENSCAFG00000016982
VGNC: 40046
UniProt: F1P907
Position
4
AA seq 1830 aa
MAPWRKTDKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLLKHKMLQGIFP
KSFIYIKEVTVEKRRNIENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFMQVQSM
MYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRDDDGNILDPDNTSV
ISLFHAHEEATDKITERIKEEMSKDQPDYGMYARISSSPTHSLYVFVRNFVCRIGEDAEL
FMSLYDPNKQTVISENYLVRWGSKGFPKEIEMLNNLKVVFTDLGNKDLNRDKIYLICQIV
RVGKMDLKDTNTKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVTAENDFL
HSLLGKVTASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPG
DVRNDIYITLLQGDFDKYNKTTQRNVEVIMCVCAEDGKTLPNAICVGAGDKPMNEYRSVV
YYQVKQPRWMETVKVAVPIEDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGT
TLQDGCHDLVVLKGESKKMEDASAYLTLPSYRHHVENKGATLSRSSSSVGGLSVSSRDVF
SISTLVCSTKLTQNVGLLGLLKWRMKPQLLQENLEKLKIVDGEEVVKFLQDTLDALFNIM
MEHSQSNEYDILVFDALIYIIGLIADRKFQHFNTVLEAYIQQHFSATLAYKKLMTVLKTY
LDTSSRGEQCEPILRTLKALEYVFKFIVRSRTLFSQLYEGKEQMEFEESMRRLFESINNL
MKSQYKTTILLQVAALKYIPSVLHDVETVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMN
EIVQSNLFKKQECRDILLPVITKELKELLEQKDEMQHQVQEKKYCVELLNSILEVLSCQD
AAFTYHHIQEIMVQLLRTVNRTVITMGRDHVLISHFVACMTAILNQMGDQHYSFYIETFQ
TSSELVDFLMETFIMFKDLIGKNVYPIDWMAMSMVQNRVFLRAINKFAETMNQKFLEHTN
FEFQLWNNYFHLAVAFITQDSLQLEQFSHAKYNKILNKYGDMRRLIGFSIRDMWYKLGQN
KICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRSGDFKKFENEIILKLDHEV
EGGRGDEQYMQLLESILMECAAEHPTIFKSVENFVNLVKGLLEKLLDYRGVMTDESKDNR
MSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCAS
QVMQTGQQHPQTHRQLKETLYEIIIGYFDKGKMWEEAISLCKELADQYEMEIFDYELLSQ
NLIQQAKFYENIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMS
QFPNAEKMNTTSAPGEDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQ
KFHYSRPVRKGTVDPENEFASMWIERTSFITAYKLPGILRWFEVVHMSQTTISPLENAIE
TMSTANEKILMMINQYQSDESLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYTRDHP
EDQERLSRLKDLIAWQIPFLGAGIKIHEKRVSENLRPFHDRMEECFKNLKAKVEKEYGVR
EMPDFEDRRVGRPRSMLRSYRQMSIISMASMNSDCSTPSKTTSESFDLELATPKTPKAEP
VEMISVGSTLPEVKLRRSKKRAKRSSVVFADEKAAAESDLKRLSRKHEFMSDTNLSEHAA
IPPRASILSQMSFASQSMPTIPALTLSVAGMPGMDDANSSPRLSQTFFPFSDGDKKTLKR
KKVNQFFKTMLASKTAEEGKQIPDFLSSDL
NT seq 5493 nt   +upstreamnt  +downstreamnt
atggccccctggcgcaaaactgacaaggagcgacacggcgtggccatatacaacttccaa
gggagtggagccccccagctctcccttcaaattggtgatgtggtgcggatacaggagacc
tgtggagattggtatagggggtacctcctaaagcacaaaatgttacagggtattttccct
aaatcctttatctacatcaaggaagtgacagtggagaaaagaagaaatatcgagaacatc
attcctgcagaaattcctctggcacaagaagtgacaacgacactttgggaatggggcagc
atctggaaacagctctacgtggccagcaaaaaggaaaggttcatgcaggtgcagtccatg
atgtatgacctgatggagtggcggtcccagctcctctcaggaactctgcccaaggatgag
ctgaaggaactgaagcagaaagtcacatccaaaattgattatggcaacaaaattcttgag
ctggacctgattgtcagagatgatgacggaaatatcttggaccctgataataccagcgtc
atcagcttattccatgcccatgaggaagcgactgataaaatcacagagcgcatcaaagaa
gaaatgtcaaaagaccagccagattatggaatgtatgcccgcatctcctcatcccccacc
cacagcctctatgtctttgtgaggaactttgtgtgccgaattggggaagatgctgagctc
ttcatgtctctgtatgaccccaacaagcaaacagtcataagtgagaactacttggtgcga
tggggcagcaagggcttcccaaaggagatcgagatgctcaacaacctgaaggtggtcttc
acggatctcggaaacaaagatctcaacagggataaaatttacttgatttgtcaaatagtc
cgagttgggaagatggatctcaaggatactaatacaaagaagtgcacgcaaggactgagg
cggccctttggggtggcagttatggacataacagacatcatcaaggggaaagcagagagt
gatgaagaaaagcagcacttcattccttttcacccagtgacagctgagaatgactttctc
cacagcctgctgggcaaagtcacagcctccaagggagacagtggagggcaaggcctctgg
gtgacaatgaagatgcttgtgggtgacatcattcagatccgcaaggactacccacacttg
gtggacaggaccactgtggtggccaggaaactgggcttcccagagatcattatgccaggg
gatgtcaggaatgacatctacatcactctattacaaggcgactttgacaagtacaacaag
accacgcagagaaacgtggaagtgatcatgtgtgtgtgcgcggaggatggcaaaacactg
cctaatgcaatttgtgtgggagctggggacaagcccatgaatgaatatcggtccgttgtg
tactatcaagtcaaacaaccacggtggatggaaacagtcaaggtggctgtccctattgaa
gacatgcagaggatccatctgagattcatgttccgacatcggtcatccctggaatctaaa
gataaaggagaaaagaactttgccatgtcctatgtgaagttaatgaaggaagatgggacc
actctgcaagatggatgccacgacttggttgtcctaaagggggagagtaagaagatggag
gatgccagtgcttacctgacacttccttcttaccgacaccatgtggaaaacaagggggcc
accctaagtcgaagctccagcagtgttggggggctctctgtcagctcccgagatgtgttc
tccatttccaccctggtgtgttccacaaagctcacccagaacgtgggcttgctgggtttg
ctgaagtggcgcatgaagcctcagctgttacaggagaacttagagaaattgaagattgtc
gatggagaggaagtggtaaagtttctccaggatactctagatgccctcttcaatatcatg
atggagcattctcaaagtaatgagtatgacatcctcgtctttgatgctttgatctacata
ataggactcattgctgaccggaaattccaacatttcaacaccgttctggaggcttatatt
caacagcatttcagtgctacactggcttacaagaaattgatgacggtgctgaagacttac
ttggatacctccagcagaggggagcaatgtgagccgatcctaagaaccctgaaagctttg
gaatatgtgttcaagttcattgtgcggtcgaggacattattttcacagctttatgaaggc
aaagaacagatggagtttgaagaatccatgagacggctctttgaatccatcaacaacctg
atgaaaagtcaatataaaacaaccatccttctgcaggtggcggctttgaaatatatccca
tctgtccttcatgatgtggagacggtcttcgatgcaaagttactcagccaactcctatat
gagttctacacctgcatcccccctgtgaaactgcagaagcagaaagtccaatccatgaat
gagatagtccagagcaacctctttaaaaaacaagaatgccgggatattctgcttcctgtc
atcaccaaagaactgaaggagctgctggagcaaaaagatgagatgcaacaccaggtccag
gagaagaagtactgtgtcgagctactcaacagcattttggaggtcctcagctgtcaggat
gcggccttcacctaccaccatatccaagaaatcatggtccagcttcttcgtacagtgaac
cggacggtcatcacgatgggacgggatcatgttctgattagtcactttgtggcatgtatg
acagccattttaaaccagatgggtgatcagcactattccttctatattgagaccttccag
accagctctgaacttgtggacttcttgatggagacattcatcatgttcaaggacctcatt
gggaaaaatgtgtatcctatagactggatggccatgagtatggttcagaacagggtcttc
ttgagagctatcaacaagttcgcagaaaccatgaaccagaagtttctggaacacacgaac
tttgagttccagctgtggaacaactattttcatctggcggtggcttttatcactcaagat
tctctgcagctggagcagttctcgcatgccaaatacaacaaaatcctgaataagtacggg
gacatgagacggctaattggcttctccatccgtgatatgtggtacaagctgggccagaac
aaaatctgcttcatcccaggcatggtgggacctatattagagatgacacttatccctgag
gctgagctccggaaagccaccataccaatcttcttcgacatgatgctgtgtgaatatcaa
aggagtggggatttcaaaaagtttgaaaacgaaatcatcctcaagctggaccatgaggtg
gaagggggccgaggagatgagcaatacatgcagctgctggagtcgatcctgatggagtgt
gctgcagagcacccgactatttttaagtcagtggaaaactttgtgaacctggtcaaaggt
ctcctggagaagctactcgattaccggggtgtgatgacggatgagagcaaagacaaccgc
atgagctgcactgtgaatctactgaatttctacaaagataacaatcgagaagagatgtac
ataaggtacctgtacaaactccgtgatcttcacctggattgtgacaattacacagaggct
gcctacacacttcttctccacacctggcttctcaagtggtcagatgagcagtgcgcatca
caggtcatgcagacaggccagcagcacccccagactcaccgacagctgaaggagacgctc
tatgagatcatcataggctactttgacaaaggaaagatgtgggaagaggccatcagcctg
tgcaaggagctggcggaccaatacgagatggagatctttgactatgagctcctgagccag
aacctgatccagcaggcaaaattctatgaaaacatcatgaaaatcctcaggcccaagcca
gactattttgctgttggatactatggccagggatttccctcctttctgcggaacaaggtg
ttcatctaccgagggaaggagtatgagcggagagaagatttccagatgcagctgatgagc
cagttccccaatgcagagaagatgaacacaacctctgcccccggggaggacgtgaagaat
gccccaggccagtacatccagtgtttcactgtccagccggtcttggatgaacatccaagg
ttcaagaataagccagttcctgaccagataataaacttttataaatccaactacgtgcaa
aagttccactactcccggcctgtgcgcaaagggaccgttgaccctgagaatgagtttgct
tcgatgtggatcgagagaacctccttcataactgcgtacaagcttccagggatcctgcgc
tggtttgaagtggttcacatgtcccagaccacaattagtcccctggagaatgccattgaa
accatgtccacggccaatgagaagatcctaatgatgatcaaccagtaccagagtgacgaa
agcctccccattaatccgctttccatgctcctgaacgggatagtggaccctgctgtcatg
ggagggttcgccaagtatgagaaggcctttttcacagaggagtatacaagggatcaccct
gaggaccaggaaagactgagccggctcaaggacctgattgcgtggcagatccctttcctg
ggagctggaattaaaatccatgagaaaagggtgtcagagaatctgcgacccttccacgac
cggatggaagaatgtttcaagaacctgaaagcgaaggtggagaaggagtatggtgtcaga
gaaatgcccgactttgaggacaggcgagtgggccgtccacggtcgatgctgcgttcctac
aggcagatgtccattatctctatggcctccatgaactctgactgcagcactcccagcaag
accacctctgagagctttgacctggaattagcaactcctaagactccaaaagcagagcca
gtggagatgatctctgtggggagcacgctgccagaagtgaagctgcggaggtccaagaag
agggccaagaggagcagcgtggtgtttgcagacgagaaggcagcagccgaatcagacctg
aagcggctttctaggaagcacgagttcatgagtgacaccaacctctcggagcatgctgcc
attccccccagggcatccatcctctctcagatgagttttgccagtcaatccatgcccacc
atcccagccctcacgctctcagtggcaggcatgcctgggatggatgacgccaactcgtcc
ccccgcctcagccagaccttcttccctttctcagacggcgacaagaagacactcaaacga
aagaaagtaaatcagttcttcaagacaatgctggccagcaaaactgctgaagaaggcaag
cagatcccggacttcctgtcctcagacctgtga

DBGET integrated database retrieval system