KEGG   Canis familiaris (dog): 489198Help
Entry
489198            CDS       T01007                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04020  Calcium signaling pathway
cfa04024  cAMP signaling pathway
cfa04080  Neuroactive ligand-receptor interaction
cfa04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    489198 (HTR4)
   04024 cAMP signaling pathway
    489198 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    489198 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    489198 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cfa04030]
    489198 (HTR4)
G protein-coupled receptors [BR:cfa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    489198 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 489198
NCBI-ProteinID: XP_022273538
Ensembl: ENSCAFG00000018345
VGNC: 41831
Position
4
AA seq 371 aa AA seqDB search
MAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFVDLLVSVLVMPFGAIELVQDIWIYGEM
FCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWIIPMF
ISFLPIMQGWNNIGIIDLERISKPRLGQDLHVIEKRKFNQNSNSTYCIFMVNKPYAITCS
VVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGAPSEGRPQPADQHSTHRMRTETKA
AKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNK
SFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESHCHPPAT
SSLVAAHPSDP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggccatcttggggaacctgctggtgatggtggctgtgtgcagggacaggcagctcagg
aagataaaaaccaattatttcattgtatctctcgcctttgtggatctgctagtttctgtg
ctggtgatgccctttggtgccattgagctggttcaagacatctggatttatggggagatg
ttttgccttgtccggacatcgctagatgtcctgctcacgacagcatcgatttttcacctg
tgctgcatttccctggacaggtattatgccatctgctgccagcctctggtctataggaac
aagatgacccctctgcgcatcgcgttaatgctgggaggctgctggatcatccccatgttt
atctcttttctccctataatgcaaggctggaataatattggcataattgatttggaaagg
atatccaagccaaggctgggccaggatttgcatgtgatagaaaaaaggaagttcaaccaa
aactccaactctacgtactgtatcttcatggtcaacaagccctacgccatcacctgctct
gtggtggccttctacatcccatttctcctcatggtgctggcctattatcgcatctacgtc
acagcaaaagagcatgcccaccaaatccagatgttacaacgggcaggagccccctctgaa
ggcaggccccagccagctgaccagcacagcactcatcgcatgaggaccgagaccaaagca
gccaagaccctgtgcatcatcatgggttgcttctgcctctgctgggctccattcttcgtc
actaatattgtggatccattcatagactacactgttcctgggcaggtgtggaccgctttc
ctctggcttggctacatcaactctgggttgaacccctttctgtacgccttcttgaataag
tcttttagacgtgccttcctcatcatcctctgctgtgatgatgagcgctaccgaagaccc
tccattctgggccagactgtcccctgttcaaccacaaccattaatggatccacacatgtg
ctaagggatgcggtggagtgtggtggccaatgggagagtcactgccaccctccagcaact
tcttccttggtggctgctcaccccagtgacccttag

DBGET integrated database retrieval system