KEGG   Canis familiaris (dog): 489464Help
Entry
489464            CDS       T01007                                 

Gene name
DVL2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X5
  KO
K02353  segment polarity protein dishevelled
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04150  mTOR signaling pathway
cfa04310  Wnt signaling pathway
cfa04330  Notch signaling pathway
cfa04390  Hippo signaling pathway
cfa04550  Signaling pathways regulating pluripotency of stem cells
cfa04916  Melanogenesis
cfa04934  Cushing syndrome
cfa05165  Human papillomavirus infection
cfa05200  Pathways in cancer
cfa05217  Basal cell carcinoma
cfa05224  Breast cancer
cfa05225  Hepatocellular carcinoma
cfa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    489464 (DVL2)
   04330 Notch signaling pathway
    489464 (DVL2)
   04390 Hippo signaling pathway
    489464 (DVL2)
   04150 mTOR signaling pathway
    489464 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    489464 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    489464 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    489464 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    489464 (DVL2)
   05226 Gastric cancer
    489464 (DVL2)
   05217 Basal cell carcinoma
    489464 (DVL2)
   05224 Breast cancer
    489464 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    489464 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    489464 (DVL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Motif
Other DBs
NCBI-GeneID: 489464
NCBI-ProteinID: XP_005620017
Ensembl: ENSCAFG00000016066
VGNC: 40138
UniProt: E2R7K2
Position
5
AA seq 732 aa AA seqDB search
MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSENPQPEMAPPAHEPRAELAPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSTGGHRPGGPSR
LERHLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRRKQRP
PRLERASSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGA
VAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFT
LPRNEPIQPIDPAAWVSHSAALTGTFPTYPGSSSMSTMTSGSSLPEGCEGRGLSIHTDMA
SVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLK
AGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGATP
WPLLPTFSYQYPTPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRT
GRPEERAPESKSGSGSESEPSSRGGSLRRGGEPGGAGDGGPPPSRGSSGGVPNLRAHPGL
HPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMA
MGNPSEFFVDVM
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcagcggcgcggggggcggcggcgtcggggagacgaaggtgatttaccacctg
gatgaggaggagactccctacctggtgaagatcccggttccggcggagcgcatcaccctc
ggtgatttcaagagcgtcctgcagcggcccgcgggcgctaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaggagatttcagatgacaacgcccgccttccctgc
ttcaacgggagggtggtgtcctggctggtgtcgtcagagaacccccaacccgagatggct
cccccagcccacgagccccgggcagagctggcaccgccccccccaccgctaccccccctg
ccaccggagaggaccagcggcatcggggactctaggcctccgtccttccaccctaacgtg
tccagcagccgggagaacctggagcctgagacggaaaccgagtcagtggtgtccctgcgg
cgggaacggcctcgtaggagagacagcacagggggccacaggcctggtggaccctcgagg
ctggagcgccacctggccgggtatgagagctcctcaacccttatgaccagcgagctggag
agcactagcctgggggactccgatgaggatgacaccatgagcagattcagcagctccacg
gagcagagcagcgcctctcgcctcctcaagcgccaccggcggcggaggaaacagcggcca
ccccgcctggagagggcttcgtccttcagtagcgtcactgactccaccatgtctctcaac
atcatcacagtcacactcaacatggagaagtacaactttctgggcatctccatcgtgggc
cagagcaacgagcggggcgacggcggcatctacattggctccatcatgaagggcggtgcg
gtggcagccgatgggcgcatcgagccgggtgacatgctgctgcaggtcaacgacatgaat
ttcgagaacatgagcaacgatgatgcagtgcgggtgctgcgggacatcgtgcacaagccg
ggccccattgtgctgactgtggccaagtgctgggatccgtctccccaggcctatttcact
cttcctcgaaatgagcccatccagccgatcgacccagctgcctgggtgtctcactcggct
gcactgactggcaccttccccacctacccgggctcctcgtccatgagcaccatgacatcc
gggtcttctctgcccgagggctgtgagggccggggtctgtccattcatacggacatggca
tctgtcaccaaggccatggcagctccggagtctggactggaagttcgagaccgcatgtgg
ctcaagatcaccatccctaacgcctttctgggctcggacgtggtcgactggctctaccat
cacgtggagggctttcccgagcggcgggaggcccgcaagtatgccagcgggctgctcaag
gcgggcctcatccgccacactgtgaacaagatcacgttttctgagcagtgctattacgtc
ttcggagacctcagtggcggctgtgagagctacctggtcaacctgtctctgaatgacaac
gatggctccagtggggcttcagaccaggacaccttggctcctctgcctggggcgaccccc
tggcctctgctgcccaccttctcctaccagtacccaactccacacccatacagcccgcag
ccgcccccctaccacgagctgtcatcctacacctatggtggcggcagtgccagcagccag
cacagcgaggggagccggagcagtgggtcaacacgaagcgatgggggggcaggccgtaca
gggaggcccgaggaacgggcccctgagtccaagtccggcagcggcagtgagtctgagccc
tccagccgtgggggcagcctccggcggggcggggagccgggtggggctggtgatgggggc
cctcccccttccagaggctcgtcagggggtgtccccaatctccgagcccaccctgggctc
catccctatgggccacccccggggatggccctcccctataatcccatgatggtggtcatg
atgcccccccctccaccccctgtcccaccagcagtgcagcccccaggggcccctcctgtc
agagacctgggctctgtgcccccagaactgacagctagccgccaaagcttccacatggcc
atgggtaaccccagtgagttctttgtggatgttatgtag

DBGET integrated database retrieval system