KEGG   Canis lupus familiaris (dog): 489487
Entry
489487            CDS       T01007                                 

Gene name
ALOXE3
Definition
(RefSeq) hydroperoxide isomerase ALOXE3
  KO
K18684  hydroperoxy icosatetraenoate dehydratase/isomerase [EC:4.2.1.152 5.4.4.7]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    489487 (ALOXE3)
Enzymes [BR:cfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.152  hydroperoxy icosatetraenoate dehydratase
     489487 (ALOXE3)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.7  hydroperoxy icosatetraenoate isomerase
     489487 (ALOXE3)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 489487
NCBI-ProteinID: XP_005620066
Ensembl: ENSCAFG00000016949
VGNC: 37814
UniProt: E2RS18
Position
5
AA seq 711 aa
MAVYRVCVTTGPYLMAGTLDNISVTLVGTCGQSPKQLLDRLGRDFAPGSVQKYKVCCSTE
LGELLLLRLHKERYAFFPKDSWYCSCVRVTAPDGTCSHFPCYQWIEGYCTLELRPGTAKT
ICQDSLPLLLDHRTRELQGRQDCYRWKVYAPGFPGIIDVSSFEEMETDKKFALTKMTPRV
DQGDSSGNRYLPGFPMKIDLPSLLHMEPNIRYSATKTASLLFNAIPASLGMKLRGLLDRK
GSWKKLDDIRNIFWCHKTVTSEYVTEHWCEDSFFGYQYLNGVNPVMLHCLSSLPSKLPVT
NDMVAPLLGPNTCLQTELERGHIFLADYWILEEAPVHCLNGRPQYVAAPLCLLWLNPQGA
LVPLAIQLSQTPGPASPIFLPTDSYWDWLLAKTWVRNSEFLVHENNTHFLCTHLLCEAFA
MATLRQLPLCHPVYKLLLPHTRYTLQVNTIARATLLNPEGLVDKVTSVGRQGLLYLISTA
LAHFTYTDFCLPDSVRARGVQAIPNYHYRDDGLRIWAAIESFVSEIVGYYYPSNMSVQQD
SELQAWVREIFTHAFLRRESSGFPHRLCTPGELVKFLTAIIFNCSAQHAAVNSGQHDFGA
WMPNTPSSMRQPPPQTKGTATLKSYLDTLPEVNITCNNLLLFWLVSQEPKDQRPLGTYPD
EHFTEEAPRRSITAFQIRLAQISREIQERNKGLELPYAYLDPPLIENSVSI
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggccgtgtaccgcgtgtgtgtgaccacgggtccctatttgatggcggggacactggac
aacatctctgtcactctggtgggcacctgtggccagagccctaaacagctgctggatcgc
ctgggcagggacttcgcccctggatctgtgcagaagtacaaggtgtgctgctccacggag
ctgggcgagctcttgctgctgcgtctacacaaggagcgctatgccttcttccccaaggac
tcatggtattgcagctgtgtccgtgtcactgcccccgatggcacctgttcccacttcccg
tgctatcagtggattgagggctactgcaccctagagctgcgcccaggaacagcgaaaacg
atttgtcaggactcccttcccctccttctggatcacaggactcgggaactccagggccga
caggactgttaccgctggaaagtctatgcccctggcttccctggcattatagacgtcagc
agctttgaggagatggagacagacaagaaatttgccttgaccaagatgacacctcgggtg
gaccaaggggacagtagcgggaatcgctacctgcctggcttccccatgaaaattgacctc
ccgtccctgctgcacatggagcccaatattcgctactcggcaaccaagacggcctccctg
ctcttcaacgccatccccgcgtccctgggcatgaagctccgtgggctgctggaccgcaag
ggctcctggaagaagctggatgacatccggaatatcttctggtgccacaagacagtcact
tcagagtatgttacagagcactggtgtgaggactccttctttgggtaccagtacttgaat
ggcgtcaatcccgtcatgctccactgcctctccagcttgcccagcaagctgcctgtcacc
aatgacatggtagcccccttgctgggacccaacacctgtctgcagacagaactagagagg
gggcacatcttcctagccgactattggatcctggaggaggccccggtccactgcctcaac
ggccgcccgcagtacgtggccgccccgctctgcctgttgtggctcaacccgcagggggcg
ctggtgcccttggccatccagctcagccagacccccgggcccgccagccccatcttcctg
cccactgactcctactgggactggctgctggccaagacgtgggtgcgcaactcggagttc
ctggtgcacgagaacaacacgcactttttgtgcacgcatttgctgtgcgaggccttcgcc
atggccacgctgcgtcagttgccgctttgtcatccagtctacaagctcctgctcccccac
actcgctacacgctgcaggtgaacaccatcgcgcgggccacgctgctcaaccccgagggc
ctagtggacaaggtcacctcggtcgggaggcaaggcctcctctacctcattagcactgct
ctggcccacttcacctacacggatttctgccttccggacagcgtgcgggcccgcggtgtc
caggccatccccaactaccattaccgggacgacggcctgaggatctgggcagccattgag
agctttgtctcagaaatcgtgggctactattatcccagcaatatgtctgtgcagcaggac
tcggagctgcaggcctgggtccgtgagatttttactcatgcattcctacgccgggaaagc
tcaggcttcccacaccggctgtgcactccaggagaactggtgaagttcctcactgcaatc
atcttcaactgctccgcccagcacgccgctgtcaacagtgggcagcatgactttggggcc
tggatgcccaacaccccgtcatccatgaggcagcctccaccccagaccaaggggactgcc
accctgaagagttacctagacaccctcccagaagtgaacatcacttgtaacaaccttctc
ctcttctggttggtcagccaggagcccaaagaccagaggcccctgggcacctacccagat
gaacacttcacagaggaggcccctcggcggagcatcaccgccttccagatccgcttggcc
cagatttccagggagatccaggagcggaacaagggcctggagctgccctacgcctacctg
gaccctcccctcatcgagaacagcgtctccatttga

DBGET integrated database retrieval system