KEGG   Canis lupus familiaris (dog): 489500
Entry
489500            CDS       T01007                                 

Gene name
RCVRN
Definition
(RefSeq) recoverin
  KO
K13764  recoverin
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    489500 (RCVRN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cfa04990]
    489500 (RCVRN)
Domain-containing proteins not elsewhere classified [BR:cfa04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   489500 (RCVRN)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 FPL EF-hand_10
Other DBs
NCBI-GeneID: 489500
NCBI-ProteinID: NP_001014303
Ensembl: ENSCAFG00000017451
VGNC: 45450
UniProt: Q8MIH6
Position
5
AA seq 202 aa
MGNSKSGALSKEILEELQLNTKFTEEELCSWYQSFLKECPSGRITKQEFQSIYSKFFPEA
DPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGAISKS
EVLEIVMAIFKMISPEDVKQLPEDENTPEKRAEKIWGFFGKKDDDKLTEEEFIEGTLANK
EILRLIQFEPRKVKEKLKEKKP
NT seq 609 nt   +upstreamnt  +downstreamnt
atggggaacagcaagagcggagccctctccaaggagatcctggaggagctgcagctgaac
accaagttcacagaggaggagctgtgcagctggtaccagtccttcctgaaggagtgcccc
agtggccgcatcaccaagcaggagtttcagagcatctactccaagttcttccctgaggcc
gaccccaaggcctatgcccagcatgtgttccgcagcttcgacgccaacagcgacggcacc
ctggacttcaaagagtatgtcatcgccttgcacatgacctcggccggcaagaccaaccag
aagcttgagtgggccttctcgctctacgacgtggacggcaacggggccatcagcaagagc
gaagtgctagagatcgtcatggctattttcaaaatgatcagtcctgaggatgtgaagcaa
cttccagaggatgagaacaccccagagaaacgagcagagaagatctggggattctttgga
aagaaagatgatgataaacttacagaggaggagttcatcgaggggaccctggctaataag
gaaattctgagactgatccaatttgagcctcgaaaagtgaaggaaaaattaaaagaaaag
aaaccctga

DBGET integrated database retrieval system