KEGG   Canis familiaris (dog): 489508Help
Entry
489508            CDS       T01007                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4 isoform X1
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04012  ErbB signaling pathway
cfa04620  Toll-like receptor signaling pathway
cfa04664  Fc epsilon RI signaling pathway
cfa04668  TNF signaling pathway
cfa04912  GnRH signaling pathway
cfa04926  Relaxin signaling pathway
cfa05142  Chagas disease (American trypanosomiasis)
cfa05161  Hepatitis B
cfa05164  Influenza A
cfa05166  HTLV-I infection
cfa05167  Kaposi's sarcoma-associated herpesvirus infection
cfa05169  Epstein-Barr virus infection
cfa05418  Fluid shear stress and atherosclerosis
Module
cfa_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    489508 (MAP2K4)
   04012 ErbB signaling pathway
    489508 (MAP2K4)
   04668 TNF signaling pathway
    489508 (MAP2K4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    489508 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    489508 (MAP2K4)
  Endocrine system
   04912 GnRH signaling pathway
    489508 (MAP2K4)
   04926 Relaxin signaling pathway
    489508 (MAP2K4)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    489508 (MAP2K4)
  Infectious diseases
   05166 HTLV-I infection
    489508 (MAP2K4)
   05164 Influenza A
    489508 (MAP2K4)
   05161 Hepatitis B
    489508 (MAP2K4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    489508 (MAP2K4)
   05169 Epstein-Barr virus infection
    489508 (MAP2K4)
   05142 Chagas disease (American trypanosomiasis)
    489508 (MAP2K4)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     489508 (MAP2K4)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: STE group
  STE7 family
   489508 (MAP2K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 489508
NCBI-ProteinID: XP_022274293
Ensembl: ENSCAFG00000017851
VGNC: 42962
Position
5
AA seq 413 aa AA seqDB search
MENSCCNILTSENDVSGLLGNSHYPVDRPIPESRSGSHSQELSALILQSCPTGKRKALKL
NFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLG
EIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYG
ALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKII
HRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDV
RSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNL
CLTKDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattcatgttgtaatattcttacttctgaaaatgatgtgtctggtcttcttggg
aattctcattatcctgtagacaggcccatccctgagagccgatccgggagtcacagccag
gagctttctgctcttatcctacagtcctgtccaactggtaaacgcaaagcactgaagttg
aattttgcaaatccacctttcaaatctacagcaaggtttactctgaatcccaaccctaca
ggagttcaaaacccacacatagagagactgagaacacacagcattgaatcatcaggaaag
ctgaagatctcccctgagcagcactgggatttcactgcggaggacttgaaagaccttgga
gaaattggacgaggagcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaa
ataatggcggtgaaaagaattcggtcaacagtggatgaaaaagaacaaaaacagcttctt
atggatttggatgtagtaatgcggagtagtgattgcccgtacattgttcagttttatggt
gcactcttcagagagggtgactgttggatctgtatggaactcatgtctacctcgtttgat
aagttttacaaatatgtatatagtgtattagatgatgttattccagaagaaattttaggc
aaaatcactttagcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaatcatt
cacagagatatcaaaccttccaatattcttctggacaggagtgggaatattaagctctgt
gactttggcatcagtggacagctggtggactccattgccaagacaagagatgccgggtgt
aggccatatatggcacctgaaagaatagacccgagtgcatcacgacaaggatatgacgtc
cgctctgatgtctggagtttggggatcacattgtatgagttagccacaggccggtttcct
tatccaaagtggaatagtgtattcgatcaactcacacaagtcgtgaaaggggaccctcca
cagctgagtaactctgaggaaagggaattctccccaagcttcatcaactttgtcaacttg
tgccttacgaaggatgaatccaaaaggccaaagtataaagaacttctgaaacatcccttt
attttgatgtatgaagaacgtaccgtagaggttgcctgctatgtttgtaaaatcctggat
caaatgccagctactcccagctctcccatgtacgttgattga

DBGET integrated database retrieval system