KEGG   Canis lupus familiaris (dog): 489525
Entry
489525            CDS       T01007                                 

Gene name
ULK2
Definition
(RefSeq) serine/threonine-protein kinase ULK2 isoform X1
  KO
K08269  serine/threonine-protein kinase ULK2 [EC:2.7.11.1]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04136  Autophagy - other
cfa04140  Autophagy - animal
cfa04150  mTOR signaling pathway
cfa05010  Alzheimer disease
cfa05014  Amyotrophic lateral sclerosis
cfa05016  Huntington disease
cfa05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    489525 (ULK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    489525 (ULK2)
   04136 Autophagy - other
    489525 (ULK2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    489525 (ULK2)
   05014 Amyotrophic lateral sclerosis
    489525 (ULK2)
   05016 Huntington disease
    489525 (ULK2)
   05017 Spinocerebellar ataxia
    489525 (ULK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    489525 (ULK2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    489525 (ULK2)
   03029 Mitochondrial biogenesis [BR:cfa03029]
    489525 (ULK2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     489525 (ULK2)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   489525 (ULK2)
Membrane trafficking [BR:cfa04131]
 Autophagy
  Autophagosome formation proteins
   Atg1 complex
    489525 (ULK2)
Mitochondrial biogenesis [BR:cfa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    489525 (ULK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF3543 Kdo RIO1 Pkinase_fungal APH Kinase-like
Other DBs
NCBI-GeneID: 489525
NCBI-ProteinID: XP_005620169
Ensembl: ENSCAFG00000018126
VGNC: 48129
UniProt: A0A5F4C7J8
Position
5
AA seq 1081 aa
MEVVGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKIL
KELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMR
ILHSKGIIHRDLKPQNILLSYANRRKSNVSGIRIKIADFGFARYLHSNMMAATLCGSPMY
MAPEVIMSQHYDAKADLWSIGTVVYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRET
SPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQVPVKKSCPVPVPVYAGSVSGSSCGSSP
SCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSASTSSKNSSCDTDDFVLVPHNI
SSDHSYDMPMGTAGRRASNEFLVCGGQCQPTVSPHSETAPIPVPTQIRNYQRIEQNLTST
ASSGTNLHGSPRSTVVRRSNTSPMGFLRLGSCSPAPADTVQTVGRRLSTGSSRPYSPSPL
VGTIPEQFSQCCCGHPQGHESRSRNSSGSPVPQAQSPQPLLLGARLQSAPTLTDIYQNKQ
KLRKQHSDPVCPSHAGTGYSYSPQPSRPGSLGTSPTKHMGSSPRSSDWFFKTPLPTIIGS
PTKTTAPFKIPKTQASSNLLALVTRHGPTEGQSKDGNDPRECSHCLLVQGSERQKSEQQN
KAVFGRSVSTGKLSDQQVKIPLGGHQGSTDSLNTERPMDIAPAGACGGVLAPPIGTAASS
RAVLFTVGSPPHSATAPTCTHMVLRTRTTSVNGYASAAFYDDDCGATGRNVYAINLFKAS
HDDVFEIHVSTRSKAGSSSSGGSVCSASGRVCVGSPPLGPCLGSSPPGAEAAPGLRYMPH
GASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLTFTECVLDLTAVRGGHPELCT
SAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASLHLAKAQIKSGKLSPST
AVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSVTAEKLIYNCAVEMVQS
AALDEMFQQTEDIVYRYHKAALLLEGLTKILQDPADIENVHKYKTSIERRLSALCCSTAT
L
NT seq 3246 nt   +upstreamnt  +downstreamnt
atggaggtggtgggcgacttcgagtacagcaagagggacctcgtgggacacggggccttc
gccgtggtcttccgggggcggcaccgccagaaaactgattgggaggtagctattaaaagt
attaataaaaagaacttgtcaaaatcacaaatactgcttgggaaggaaattaaaatctta
aaggaacttcaacatgaaaatattgtagcactctatgatgttcaggaattacccaactct
gtctttttggtgatggagtactgcaatggtggagacctggcagattatttgcaagctaaa
ggaactcttagtgaagacacgattagagtgtttctgcatcagatcgcagctgccatgcga
attctgcacagcaaaggaataatccacagggatctcaaaccacagaatatcttgctgtca
tatgccaatcgcagaaagtccaacgtcagtggtattcgcatcaaaatagcggattttggg
tttgctcgttatctacatagtaacatgatggctgcaacgctgtgtgggtccccaatgtac
atggctcctgaggttattatgtctcaacattatgatgctaaggcagacctgtggagcata
ggaacagtggtatatcaatgcctagttggaaaaccaccttttcaggccaatagtcctcaa
gacctaaggatgttttatgaaaaaaacagaagcttaatgcctagtattcccagagaaaca
tcaccttatttggctaatctccttttgggtttgcttcagagaaaccagaaagacagaatg
gactttgaagcattttttagccatccttttcttgagcaagttccagtgaagaaatcttgc
ccagtcccagtgcccgtgtacgctggctctgtctctggaagctcctgtggtagctctcca
tcttgtcgctttgcatctccaccatcccttccagatatgcagcatattcaggaagaaaac
ttatcctccccaccattgggtcctcccaactacctacaagtgtccaaagattctgccagt
actagtagcaagaactcttcttgtgacacggatgactttgttttggttccacacaacatc
tcgtcagaccactcatatgatatgccaatggggactgctggcagacgtgcttcaaatgag
tttttggtgtgtggagggcagtgccagcctactgtgtcacctcacagtgaaacagcacca
attccagttcctactcagatacggaattatcagcgcatagagcagaaccttacatctact
gccagctctggcacaaatctacatggttctccaagatctacagtggtacgaaggtctaac
accagtcctatgggcttcctccggctgggatcttgctccccagcaccagcagacacagta
cagacagttggacgaagactctccactgggtcttccaggccttactcaccctcccccttg
gttgggaccattcctgagcagtttagtcagtgctgctgtgggcatcctcagggtcatgaa
tccaggagtagaaactcatcaggttctccagtgccacaggctcagtcaccacagcctctc
ctgttgggcgctagactgcagagcgcccctaccctcaccgacatctaccagaacaagcag
aaactcagaaagcagcactcggaccctgtgtgcccatcccatgctgggactgggtacagc
tactccccccagcccagtcggcctggcagccttggaacctctcccaccaagcacatgggg
tcctctcctcggagttctgactggttctttaaaactcctttaccgaccatcattggctct
cctactaagaccacagctcctttcaaaatacctaaaactcaagcgtcttccaacctgcta
gccttggttactcgtcatggacctactgaagggcaatctaaagatgggaatgacccacgg
gaatgctctcattgtctcttagttcaaggaagtgagaggcagaagtctgagcagcagaac
aaagcagtgtttggcagatctgtcagtactggaaaattatcagatcaacaagtgaagata
cctttaggtggacatcagggcagcacagacagtttaaatacagaacgaccaatggatata
gcccctgcaggagcttgtggtggtgtactggcacctcctataggaacagcagcaagttcc
agggctgtcctgttcactgtaggatctcctccacacagtgccacggcccccacttgtacc
catatggtccttcgaacaagaacaacctcagtgaacggctatgcatccgctgcattttat
gatgatgactgtggagcaacagggagaaatgtgtatgctataaacttgtttaaagctagc
catgatgatgtcttcgaaatacacgtatcaacaagaagtaaagccggctccagcagctcc
ggaggctccgtatgctctgcaagtggccgcgtgtgtgtgggctccccgccgctgggtccg
tgcctggggtcttcccctccaggagcagaggcagctcccggcctgagatacatgcctcat
ggtgcttcaccccccagcctagaggggctcatcacctttgaggcccccgaactgccagag
gaaacactgatggagcgggaacacacagacaccttacgccacctgaacgtgatgttaacg
ttcactgaatgtgtgctggatctgacagccgtgcggggaggacacccggagctgtgcaca
tctgctgtctccttataccagatccaggagagtgtggttgtggaccagatcagccaacta
agcaaagactgggggcgggtggagcagctggtgttatacatgaaagcggcacagctatta
gcagcctctctgcatctcgccaaagcccagatcaagtccgggaagctgagcccatccaca
gctgtgaaacaagttgtcaaaaatctgaacgaacgatataaattctgcatcaccatgtgc
aagaagcttacagaaaagctgaatcgcttcttctctgacaaacagagatttattgatgaa
atcaacagtgtgactgcagagaaactcatctataattgtgctgtagaaatggttcagtct
gcagccctggatgagatgtttcagcagactgaagatattgtttatcgttatcacaaggca
gcccttcttttggaaggcctcactaagattctccaggaccctgcagatattgaaaatgta
cataaatataaaactagtattgaaagaagattgtcagcactctgctgtagcaccgcgacg
ctgtga

DBGET integrated database retrieval system