KEGG   Canis familiaris (dog): 489547Help
Entry
489547            CDS       T01007                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04015  Rap1 signaling pathway
cfa04218  Cellular senescence
cfa04620  Toll-like receptor signaling pathway
cfa04664  Fc epsilon RI signaling pathway
cfa04668  TNF signaling pathway
cfa04714  Thermogenesis
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04912  GnRH signaling pathway
cfa05014  Amyotrophic lateral sclerosis (ALS)
cfa05145  Toxoplasmosis
cfa05164  Influenza A
cfa05169  Epstein-Barr virus infection
Module
cfa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    489547 (MAP2K3)
   04010 MAPK signaling pathway
    489547 (MAP2K3)
   04668 TNF signaling pathway
    489547 (MAP2K3)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    489547 (MAP2K3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    489547 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    489547 (MAP2K3)
  Endocrine system
   04912 GnRH signaling pathway
    489547 (MAP2K3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    489547 (MAP2K3)
  Environmental adaptation
   04714 Thermogenesis
    489547 (MAP2K3)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    489547 (MAP2K3)
  Infectious diseases
   05164 Influenza A
    489547 (MAP2K3)
   05169 Epstein-Barr virus infection
    489547 (MAP2K3)
   05145 Toxoplasmosis
    489547 (MAP2K3)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     489547 (MAP2K3)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: STE group
  STE7 family
   489547 (MAP2K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH Choline_kinase RIO1 DUF4344
Motif
Other DBs
NCBI-GeneID: 489547
NCBI-ProteinID: XP_546666
Ensembl: ENSCAFG00000018530
VGNC: 42961
UniProt: F1PXD3
Position
5
AA seq 347 aa AA seqDB search
MESPASSQPASMPQTKGKSKRKKDLRISCMSKPPVPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTLDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagtcccccgcctccagtcagcccgctagcatgccccagaccaaagggaaatccaag
aggaagaaggatttacggatatcctgcatgtccaagccacctgtacccaaccccacaccc
ccccggaacctcgactcccggaccttcatcaccattggagataggaactttgaggtggag
gccgatgacctggtgaccatctcagagctgggccgaggagcctacggggtggtagagaag
gtgcgacatgcccagagtggcaccatcatggctgtgaagcggatccgggccaccgtgaac
tcacaggagcagaagcgtctgctcatggacttggacatcaacatgcggacggtcgactgc
ttctatactgtcaccttctatggggccctcttcagagagggagatgtgtggatctgcatg
gagctcatggacacatccctggacaagttctaccggaaggtgctcgataaaaacatgacc
attccagaggacatcctgggggaaattgctgtgtctatcgtgagggctctggagcacctg
cacagcaagctgtcggtgatccatagagacgtgaagccgtccaatgtcctcatcaacaag
gagggccacgtgaagatgtgcgactttgggattagtggctacttggtggattctgtggct
aagacgctggacgctggctgcaagccctacatggctcccgagagaatcaacccagagctt
aaccagaagggctacaatgtcaagtctgatgtctggagtctcggcatcaccatgattgag
atggccattctacggtttccgtatgaatcctgggggactccgttccagcagctgaagcag
gtggtggaagagccatctccccagctcccggccgaccgtttctctcctgagttcgtggac
ttcactgcacagtgcttgaggaagaaccccgcggagcgcatgagctacttggagctgatg
gagcacccattcttcacattgcacaaaaccaagaagacggacattgcggccttcgtgaag
gagatcctgggggaggactcatag

DBGET integrated database retrieval system