KEGG   Canis familiaris (dog): 489812Help
Entry
489812            CDS       T01007                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear envelope pore membrane protein POM 121C
  KO
K14316  nuclear pore complex protein Nup121
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03013  RNA transport
Module
cfa_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    489812
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     489812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POM121
Motif
Other DBs
NCBI-GeneID: 489812
NCBI-ProteinID: XP_013969651
Position
6
AA seq 1089 aa AA seqDB search
MGSYLGKPGPPQPAPAPEARDLLERPGRRRAPARAAPPAHSAHLVHHTHPSLPTPLLRPP
RRPSHRDCGTLSNRFVITPRRRYPIQQAQYSLLGVLPTVCWNGYHKKTVLSARNSKMVCS
PVTVRIAPPDSKWIRSPIPEQTINSTLSSPSSNAPDPCAKETVLSALKERKKRTVEEEDQ
IFSDSQENKRRRHDSSGSGHSAFEPLVANGVPAAFVPKPGSLKRGLNSQSSDDHSNKRSR
TSSMSSLTSTYTGGIPSSSRNAITSSYSSTRGFSQFWKRSGPSSSPFSSPASSRSQTPER
PAKKIREDELSHHSSSSTPLAADKEAQGEKAADTTTSKAQNSWSSPPTPGSSGQRKRKIQ
LLPSRRGARLTLPPPPQLGYSITAEDLDLEKRASLRWFNKALADGTDTSSNSVTEKPPTT
QPSLTFTPPAAGTTTSPATLPAPNTNPLLESLKKMQSSASLPSSSESAGVATTVAPSPPK
TPSLLPSLSSSQSGALPGASSDSKSTATFSGLTPAASLTPATDTTKSPLAPQAETSAKPA
APPTPSPTPKQSLLLGMLSTPPADPPASTPPTVSSASPMFKPIFMAPPKSENEGPLPSSP
SKVTTTTPSSSALLAPTSSPQPVFKPIFGNMGPPTSTPLSAAFFSQTTASAGRDASTPLF
PSQASATSTVAPVSAASTSIDSASKPTFSFGVSTVTSTTTSAAQPFLFGPPPTSGASFSP
AIGSIFQFGKPPVAPVSDNVTTFGQSVPGAVQTATSSSSSSSSSSSASACFSGFSGSLTT
PAPATSSQPALTFTTTTTPAFHIPFGSSTKPTLPSYPGANPQPTFGATDGQQQGATKPGL
APSFGSSFTFGNTAAAAPAATPAPGPAQPTFGSPAQASFGGLKPTAPAFGTPANTQPAFG
STTSVFSFGAASTSGFGATTQTTSSGTGSSMFGSTTLSPFTFGGSAGPASSGGFGINVAT
PGTSGAFSFGTGQSGAAASTTPFGGGLSQSTLGAPSQSTPFAFNVASTPESKPVFGGTST
PSFGQNTPAPGVGVSGSGLSFGASSTPTQGFVGVGPFGSAAPSFSIGAGSKTPGARQRLQ
ARRQHTRKK
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgggcagttacctgggcaagcccggccccccgcagcctgcacccgccccggaggccagg
gacctactggagaggcctggccgccgccgagcacccgctcgcgccgcgccgcctgcgcac
tcggcccatcttgtgcaccacactcacccctctctccccactcctcttctccgaccccct
aggaggccttcccaccgggattgtgggactttatcaaaccggtttgtaataacacctcga
agacgatatccaatccagcaggcccaatattcccttctgggggtacttcctacagtgtgc
tggaatggttatcacaagaagactgtgctatctgctcgtaattccaaaatggtgtgcagc
ccagtgacagtgaggattgctcctccagatagtaaatggattcgttcaccaataccagag
cagacaatcaactcaacgctgtcctcaccatcaagtaatgccccagatccatgtgcaaag
gagaccgtactgagtgccctcaaagagaggaagaaaaggacagtggaggaggaagatcaa
atattttctgatagccaggaaaataaaagaaggcgccatgatagcagcgggagtggacat
tcagcatttgagcccctggtggccaacggagtccccgctgcttttgtgcctaagcctggc
tctctgaagagaggtctcaattcccagagctcagatgaccactcgaataagagatctcgc
acctcttccatgagctccttgacgagcacatacacaggtggcatccctagctccagtcgc
aatgccattactagttcttacagttctactcgaggtttctctcagttttggaagagaagt
gggcccagctcatcaccattctctagcccagcctcatctcgctcccagacaccagagagg
ccagcaaagaaaatcagagaagatgagctttctcatcactccagttcttcgactccattg
gcagcagacaaggaggcccagggagaaaaagctgcagatacaaccacgtcgaaggcacag
aactcgtggagctccccgcccacacctggcagctctgggcagcgcaagcggaagattcag
ttgctgccctcccggcgaggggcccggctgaccctgcccccacctccccagcttggctat
tctatcactgctgaagacctggatctggaaaaaagagcctcactgcggtggtttaacaag
gccttggcagatgggaccgatacttcctcgaattctgtcactgagaagccccctaccact
cagccttctctgacgttcaccccgcctgctgctgggaccaccacctccccagctaccctc
ccagccccaaacaccaacccgctgctcgagagcttgaagaagatgcagagttctgctagc
ctgccatcttcttcggaatctgccggagtggcaaccactgtggccccttcacctccgaag
acacccagcctgctgccctctctcagctcttcacagtcaggggcccttccaggcgcctcc
tcggactccaagtccacagccactttctcggggctgacccctgctgcgtccctgacgcca
gccaccgataccaccaagtcacctctggctcctcaggctgagacatctgccaaacctgca
gccccgcccaccccatcccccacccccaagcagagtcttctgctgggaatgctgagcacc
ccgcctgctgacccccctgcgtcgacgccccccaccgtgtcatccgcgtcccccatgttc
aagcccatcttcatggccccaccaaaaagtgagaatgagggccccttgccatctagcccc
tcgaaggtcaccaccacgaccccttccagctctgccctccttgcacccacgagcagccct
cagcccgttttcaagcctatcttcggcaacatggggcccccgacatccacgcccttgtct
gctgccttcttcagccagaccacggcttccgcaggcagagatgcgagtacccctctcttc
cccagccaggccagtgccacctcaaccgtggctcctgtgagcgcagccagcacttctata
gactcagcttcaaagcccacgttcagctttggcgtgagcactgtgaccagcaccaccacc
tctgctgcccagcctttcctctttgggcccccccccacctccggggccagctttagccca
gccataggctccatattccagttcggcaagccgcctgtggcacccgtgtcagacaacgtc
accacatttggccaatccgtccctggggctgtgcagacagccaccagcagcagcagcagc
agcagcagcagcagcagcgccagcgcctgcttcagtgggttcagtggcagcctcaccacc
cccgcccctgctaccagcagccagccagcgctgaccttcaccaccaccaccaccccagcc
ttccacattccctttggctcaagcaccaagcccactctcccttcatatccaggagccaat
ccccagcccacatttggggctaccgacgggcagcagcagggtgccactaagccaggccta
gccccgagcttcggcagctctttcacttttgggaacacggcagctgcggccccagccgca
accccagcgcctggcccagcccagcccacctttggcagccctgcacaggctagttttggt
ggtttgaagcccactgcccctgccttcggcacccctgctaacacccagccagcctttggc
agcaccacatctgtattctctttcggggcggcctccacctctggctttggagctacaacc
cagaccaccagcagcgggaccggtagctctatgtttggcagcacaacactgtcacccttc
acgtttgggggatcagctggcccagctagcagcgggggctttgggatcaacgtggccacc
cctggcacctctggagcgttcagcttcggcacaggacaaagtggggctgctgccagcacg
accccttttggaggaggcttgagtcagagcacgttgggcgcacctagtcagagcacacct
tttgccttcaatgtggccagcacaccggagagcaaacccgtgtttggaggtacctccaca
cccagctttggtcagaacacccctgcccctggggtgggcgtgtcaggcagtggtctctcc
tttggggcatcctcaacacccacccaaggctttgttggagttggacctttcggatcggcg
gccccttccttttccattggtgcaggatccaagaccccgggggctcggcagcgactgcag
gcccgccggcagcatacccgcaagaaatag

DBGET integrated database retrieval system