KEGG   Canis lupus familiaris (dog): 489819
Entry
489819            CDS       T01007                                 
Symbol
RASA4B
Name
(RefSeq) ras GTPase-activating protein 4B isoform X2
  KO
K17630  Ras GTPase-activating protein 4
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    489819 (RASA4B)
SSDB
Motif
Pfam: C2 RasGAP BTK PH PH_10
Other DBs
NCBI-GeneID: 489819
NCBI-ProteinID: XP_005621052
Ensembl: ENSCAFG00000013668
Position
6:9378179..9401012
AA seq 802 aa
MAKRSSLSIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVH
LPPTFHAVAFYVMDEDALSRDDVIGKVCLTRDTLAAHPKGFSGWAHLTEVDPDEEVQGEI
HLRLEVVRGPGPCRLRCSVLEARDLAPKDRNGASDPFVRVRYNGRTQETSIVKKSCYPRW
NETFEFELEEGAAEALCVEAWDWDLVSRNDFLGKVVFNVQRLWAAQQEEGWFRLQPDQSK
SRRGEGSLGSLQLEVRLWDETVLPSGCYQPLVQLLCHEVKLGTQGPGQLIPLIEETTSTE
CRQDVATNLLKLFLGQGLAKDFLDLLFQLELGRTSEANTLFRSNSLASKSMESFLKVAGM
RYLHGVLGPIIDRVFEEKKYVELDPSRVEVKDVGCSGLHRPQTEAEVLEQSAQTLRVHLG
ALLSALSRSVRACPAVVRATFRQLFLRVRERFPGAQHENVPFIAVTSFLCLRFVSPAIMA
PKLFHLRERHADARTSRTLLLLAKAVQNVGNMDTPASRAKEAWMEPLQPTVRQGVAQLKD
FITKLVDIGEKEELDLQRALSLQAPPVKEGPLFIHRTKGKGPLMSSFKKLHFSLTTEALS
FAKTPNSKKSALIKLANIRAAEKVEEKSFGSSHVMQVIYEDDAGKPQTIYLQCKCVNELN
QWLSALRKMSISNPGLLGSYHPGIFRGDKWSCCHQKDKSDLGCDKTRSRVTLQEWNDPLD
HDLEAQLIYRHLLGVEAMLREKQRELSAAGTEAGSALRGSGEAPKDPLAQLFQVLQDLRE
AHRSSPASVPPSETNRLLELQT
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggccaagcgcagctcgctgtccatccgcatcgtggaggggaagaacctgcccgccaag
gacatcactggcagcagtgacccctactgcatcgtgaaggtggacaatgaacccatcatc
cggacagccactgtgtggaagaccctgtgtcccttctggggcgaggagtatcaggtgcac
ctgccgcccaccttccacgcagtggccttctacgtcatggatgaggatgccctcagccgg
gacgacgttatcgggaaggtctgtcttaccagggacaccctggccgctcaccctaagggg
ttcagtggttgggcccacctgacggaggtcgaccctgatgaggaggtgcaaggcgagatc
cacctgcgcctggaggtggtgcgagggccagggccctgccggctgcgctgctctgtgctg
gaggccagagacctcgctcccaaggatcggaatggtgcatctgacccctttgtccgagtg
cgctacaacggccggacgcaggagacctcgatcgtgaagaaatcatgctacccacgttgg
aacgagacgtttgagtttgagctggaggaaggggctgcggaggcgctgtgtgtggaagcc
tgggactgggatcttgtcagccggaatgatttcttgggcaaagtggtgttcaatgtccag
cgactatgggcagcacagcaggaggaaggctggttccggctgcagcccgaccagtccaag
agtcggcggggagagggcagcctgggctccttgcagctggaggtgcggctgtgggacgag
acggtactcccctctggctgctaccagcccctggtgcagctgctgtgccatgaggtgaag
ctgggcacccagggcccagggcagctgataccacttattgaggagacaacaagcacggag
tgccgccaggatgtggccaccaacctgctcaagctcttcctggggcagggactggccaaa
gactttctggacctgctcttccagctggagctgggtcgtaccagtgaggccaacaccctg
ttccggagcaactctctggcctcaaagtccatggaatcttttctgaaggtggctgggatg
cgctatctgcacggcgtcctggggcccatcattgacagggtgttcgaggagaagaagtac
gtggagctggaccccagcagagtggaggtcaaggacgtagggtgctcggggctgcaccgc
ccacagacggaggccgaggtgctggagcagagcgcgcagacgctgcgcgtccacctgggg
gcgctgctgagcgcgctcagccgctccgtgcgcgcctgccccgccgtggtccgagccacg
ttccgccagctcttcctgcgcgtgcgcgagcgcttccccggcgcgcagcacgagaacgtg
ccgttcatcgccgtcaccagcttcctgtgcctgcgcttcgtgtctcctgccatcatggcg
cccaagctcttccacctgcgcgagcggcacgcggacgcgcgcaccagccgcaccctgctc
ctgctggccaaggcggtccagaacgtgggcaacatggacacaccggcctccagagccaag
gaggcttggatggagccgctgcagcccaccgtgcgccagggtgtggctcagctgaaggac
ttcatcactaagttggtggacatcggggagaaggaggagctggacctgcagcgggcgctg
agcttgcaggcaccaccggtgaaggaggggccactcttcatccacaggaccaagggcaag
ggccccctcatgtcctccttcaagaaactccacttttccctcaccaccgaggccctgagc
ttcgccaagacacccaactctaagaaaagtgccctcatcaagctagccaatatccgggca
gcagagaaggtggaggagaagagctttggcagctcacacgtcatgcaggtcatctacgag
gatgacgcaggcaagccccagaccatctacctgcagtgcaagtgtgtgaacgagctgaac
cagtggctgtctgcgctacggaagatgagcatcagcaaccctggcctgctgggctcctac
caccccggcatcttccgcggggacaagtggagctgctgccaccagaaggacaagtcagat
ctgggctgtgacaagactcggtcacgtgtgaccctacaggagtggaatgaccctctggat
catgacctggaggcccagctcatctaccggcacctgctgggtgtggaggctatgctgagg
gagaagcagcgggagctgagtgcagcaggcacagaggcaggctctgcacttaggggctca
ggggaagcccccaaggatccactggcccagctgttccaggtgctgcaggacctccgggag
gcccacagatccagcccagccagcgtaccgccctcggagacaaaccgcctgctggagctg
cagacgtga

DBGET integrated database retrieval system