KEGG   Canis lupus familiaris (dog): 489956
Entry
489956            CDS       T01007                                 

Gene name
GTF3C1
Definition
(RefSeq) general transcription factor 3C polypeptide 1 isoform X2
  KO
K15199  general transcription factor 3C polypeptide 1
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cfa03021]
    489956 (GTF3C1)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     489956 (GTF3C1)
SSDB
Motif
Pfam: B-block_TFIIIC Menin
Other DBs
NCBI-GeneID: 489956
NCBI-ProteinID: XP_005621445
Ensembl: ENSCAFG00000017408
VGNC: 41551
UniProt: E2RKF8
Position
6
AA seq 2124 aa
MDALESLLDEVALEGLDGLCLPALWSRLETRVPPFPLPLEPYTQEFLWRALATHPGISFY
EEPRERPDLQLQDRYEEIDLETGILESRRDPVPLEDVYPIHMILENKDGIQGSCRYFKER
KNITNDIRTKSLQPRCMMVEAFGRWGKRLIIVASQDMRYRALIGLEGDPDLKLPDFSYCI
LERLGRSRWQGELQRDLHTTAFKVDAGKLHYHRKILNKNGLITMQSHVIRLPTGAQQHSI
LLLLNRFHVDRRSKYDILMEKLSGVLSTRSHQIETLGRLREELGLCERTFKRLYQYMLNA
GLAKVVSLPLQEIHPECGPCKTKKGTDVMVRCLRLLKEFKRKVEDDHDQDDDEDEEVISK
AVPPVDIVYERDMLTQTYELIERRGTKGISQAEIRVAMNVGKLEARMLCRLLQRFKVVKG
FMEDEGRQRTTKYISCVFAEESDLSRQYKREKARSQLLTTVSLASIQEESLVPEGEDTFL
SESDSEEESSGKKKGRASQSDGKASLNSSLRTQPHHSMSAKGGWKVVNPHPLKKQLPSSL
GGAEEKACQSSAGRDSLQDTSTSMQDTSTSSMSFGSHRMRNSNGDMTVIEEVRHENTKES
SSSQKAGKHGPGQDKPHETYRLLKRRNLIIEAVTNLRLIESLFTIQKMIMDQEKQEGVST
KCCKKSIVRLVRNLSEEGLLRVYRTTVIQDGIKKKVDLVVHPSMDQNDPLVRSAIEQVRF
RISNSSTANRIKVPQPPAPQEVEEESEGKEGPSGSGDSEPNASSKPESGRVKKTDEKMGI
TQLKNYNPVVVPGLGRSLGFLPKMPRLRAIHTFLWYLIYGHPVTYPGDKPGPGSSRRIGR
QEPSRVRVLPSRSDLEASSDAPRKDYQEITLMETEVELPTEKVYVEEASWKRYVPPIPIH
NEFGFGWALVSDILLCLPLSIFVQIVQVSYKVDNLEEFLNDPLKKHTLIRFLPRSIRQQL
LYKRRYIFSVVENLQRLCHMGLLQFGPTEKFQDKDQVFVFLKKNAVIVDTTICDPHYNLA
HSSRPFERRLYVLNSMQDVENYWFDLQCVCLNTPLGVVRYPRVRKNSTQDHGVDEEGSLR
KEQECAIDKHNLERKCAMMEYNTGSREVVDEGFIPGDGLGAAGLDSSFYGHLKRNWIWTS
YIISKAKKENTTSENGLMVRLQTFLSKRPLPLGAGGSGRLNIWGEARPGSELCADWEEQF
EIGQEPTLDRNRRVRGGRSQKRKRLRKDLGKKIKKKKKEESPQEKNRSLRYHDEADQSAL
QRMTRLRVTWSIQEDGLLMLCRIASNVLNTKVKGPFVPWQVVRDILHSTFEESLDKTSHS
VGRRARYIVKNPQAYLNYKVCLAEVYQDKALVGEFMNRKCDYEDPKVCASEFKEFVEKLK
EKFSSALKDPNLEIPDTLQELFARYRVLAIGDEKDLTRKEDELNSVDDIHFLVLQNLIQS
TLALSESQMESCRSFQTFRLYREYKDHILVRVFMECQKRSLVNRRRVNHMLGPKKNRALP
FVPMSYQLSQTYYRIFMWRFPSTVCTESFQFFSKILAAGKLDQPDTFSFKDEDNSKSSND
LVAFSLDSPGGHCVAALTLFSLGLISVDVQIPEQIVVVDSSMVENEVMKSLGKDGGLDED
DDEEEDLDEGSGGKRRAIEVKARQASHTNYLLMRGYCAPGIVSTRNLNPNDSIVVNSCQV
KFRLRRTPTPTRLWPTVPCLEELPMGISSLPDSFTRLIKSQEDPCSLEEFVHQVELCGYE
PGDVCAVLEVHGVIAATGCFGVDRVELSKWFSAFERTDAERTRTFTDYVQDLLEHHQVLE
VGGNTTRLVAMGSARPWLLHSVRPKGKEEHVYPPREDPRARPQDRPARKDSPSERHSQGP
QSTKRRASWTSSDVASQGSGPDPESTLKPPAKRPTLQDVRLAPSPRPIAEEEPEPLASAL
PAAPRDAYVEELPLGAPEAGQEDQEDTGEPRLPGQEQLSCQDQFPEGSEDPRGLAESSVA
GSVSQTTWEKDCESISFIARPWRIVDGHLNIPVCKGMMEALLYHIMSRPGIPESCLLQHY
QGVLQPVAVLELLQGLESLGCIKKCSLRRPTAVSLFSKPRVLEAQEPSSPSESPTVFYEP
TLDCTLRLGRVFPHEINWNKWVHL
NT seq 6375 nt   +upstreamnt  +downstreamnt
atggacgcgttggagtcgttgttggacgaggtggccctggaggggctcgatggcctgtgt
ctgccggcgctctggagccgtctggagacgcgagtgcctcccttcccgctgcctttggag
ccctacacgcaggagttcctgtggcgggccctggccacgcacccgggcatcagcttctac
gaagagcctcgggagcgacccgacctccagctccaggaccggtatgaagagattgacttg
gaaaccggcattttggagtcccggagggatccagtccccttggaggatgtctaccccatt
catatgatcttagagaacaaggatggcatccagggctcatgccggtacttcaaggagagg
aaaaacataaccaatgacatcaggaccaagtctttacagccccgatgtatgatggtggaa
gcctttggcaggtggggaaagagactgatcatcgttgcctcccaggacatgcgttacagg
gccttgataggcttggagggtgaccctgacctgaagctccccgacttctcctactgcatt
ctggagcgattaggccggtcccggtggcaaggggagctccagcgagacctccataccact
gctttcaaggttgatgctggcaagctccattatcaccggaaaattctgaacaaaaacggg
ctcattacaatgcagtcacatgtgatccgattacccactggagcacagcagcactcaatt
ctcctcctcctgaatcggtttcatgtggacaggaggagcaaatatgacatcctcatggag
aaactctcaggggtgctgagcacacggagtcaccagatagagaccctgggcaggctgagg
gaagaactgggtctgtgtgagaggacatttaagcggctgtaccagtacatgctgaacgct
ggccttgcgaaggtggtatctctccccttgcaagagatccaccctgagtgtggaccctgt
aagacaaagaaagggacggatgtcatggtacgctgcctccggctgctgaaggaatttaaa
cggaaggtcgaggatgaccatgaccaggacgatgacgaggacgaggaggtcatctctaag
gcagtgcccccggtggacatcgtgtacgagcgggacatgctcacgcagacctatgaactc
attgagcgcagaggcacgaaaggaatttcccaagctgaaatccgagtggctatgaatgtg
ggaaagctggaagcaagaatgctgtgtcgccttcttcagagattcaaggttgtcaagggg
ttcatggaagatgaagggcggcagcggaccaccaagtacatctcctgcgtgtttgcggaa
gagagcgatctaagccggcagtacaagagggagaaagcccggagccagctgctgaccaca
gtgagcctggcctccattcaggaggaatcactcgtgcctgaaggggaagacaccttcctt
tctgagtcagacagtgaggaggagagcagcggcaagaagaaagggagagcatcccagagt
gacgggaaagccagcttgaactccagtctcaggacacagcctcatcactccatgtcagca
aagggtggctggaaggtcgtaaacccccacccactgaagaagcagctgccttcctcccta
ggaggggctgaggagaaagcctgccagagctctgccggcagggacagcctccaggacacc
agcacctccatgcaggacaccagcacctccagcatgtcctttggctcccaccgcatgagg
aatagtaatggtgacatgaccgtgattgaagaggtcaggcatgaaaacacaaaggagagc
agcagttcgcagaaagcagggaagcatggcccaggccaagacaaaccccacgaaacttac
cggttgctcaaacgcaggaacctgatcatagaagctgttaccaacctacgcttaatcgag
agcttattcacgattcagaaaatgatcatggatcaggagaagcaagaaggcgtgtctacc
aagtgctgtaagaagtccatcgtccgcttggtgcggaacctctctgaggagggtctcctg
agagtgtatcggactacagttattcaggatggcatcaagaagaaggtggatctggttgtg
cacccgtccatggaccagaatgaccctctggtgagaagtgccattgagcaggtccgtttc
cggatctccaattccagcacagcaaacaggattaaagtaccccagcctccagcacctcaa
gaagttgaagaagaaagtgaaggaaaagagggtccgagtggatcaggagactctgagcca
aatgcttcctctaaaccagaaagcggacgggtgaagaaaactgatgagaaaatgggcatc
acccagctgaaaaactataaccctgtcgtagttccaggactcggccgttctctagggttt
ctgcccaaaatgcctcgcctgcgggcaatacacacgtttctgtggtacctaatctacggg
catcctgtcacctacccgggggacaagccaggccccggcagttcaagaagaatagggagg
caggaaccaagcagggtgagagtcctgccctcccgaagtgacctggaagcctcctctgat
gccccacgcaaggactaccaagaaataaccctcatggagaccgaagtggagctccccacg
gagaaagtttatgtggaagaagcctcctggaaacgctatgtccctcccatcccaatccac
aacgagtttggcttcggctgggctctcgtcagtgacattctcctctgcctgcccctctcc
atctttgttcagattgtgcaagtcagttacaaggtagacaaccttgaggagtttctgaat
gaccctctgaagaagcacacgctgatccgctttctgcccaggtccatccggcagcaactt
ctgtacaagagacgttatatcttttccgtggtggagaacctccagaggctgtgccacatg
gggctgctgcagtttggccccacagaaaagttccaggataaagatcaggtcttcgttttc
ttgaagaagaatgcagtcattgttgacaccaccatctgtgacccacattacaacctggcc
cacagcagccggccctttgaaaggcgtctgtatgtcctgaactccatgcaggatgtggag
aactactggttcgacctgcagtgtgtctgtctcaacacccctttaggtgtggtacgctac
ccacgtgtcaggaagaacagcacccaggatcacggcgttgatgaggagggcagtctgcgg
aaggagcaggaatgtgccatcgacaagcacaacctggagcgcaagtgtgccatgatggag
tacaacacggggagccgtgaggtagtggatgaaggcttcatccctggggatgggctggga
gccgctgggctcgattccagtttctatgggcacctaaagcgcaactggatctggaccagc
tacatcatcagcaaggccaagaaggagaacactacttctgaaaatgggctcatggtgagg
ctccagacgtttctgtccaagcgcccattaccactcggtgctggaggtagtggcagattg
aatatctggggggaagccagaccaggatctgagctgtgtgctgactgggaagaacagttt
gagattggccaagagcccacgctggacaggaaccgaagagtgaggggtgggagaagccag
aaacggaaacggctgaggaaggacctcggaaagaagatcaagaaaaagaaaaaagaagag
tccccccaagagaaaaacaggagcctgcgttaccacgacgaggccgaccagagcgccctg
caaaggatgacccgactgcgcgtcacctggtccatacaggaagatgggctgctcatgctc
tgccgcattgccagcaatgtcctcaacaccaaggtaaagggcccatttgtcccctggcaa
gttgtgcgggacatcttgcactctacttttgaagagtctctggataagacatctcattca
gttggacgaagagctcgctacatagtcaaaaacccacaagcctatctgaactataaagtt
tgcctcgctgaggtgtaccaggataaggcccttgttggagaattcatgaatcgaaaatgt
gactacgaagacccaaaggtttgtgccagtgagtttaaagaatttgtggagaagctcaaa
gagaagttcagttctgctctaaaggatcccaaccttgaaatcccagacacactccaggag
ctgtttgccagataccgagttttggcgattggagatgaaaaggatctaaccaggaaagag
gatgaacttaatagcgtggatgacatccacttcctggtgctccagaacctgatccagagc
acactggccctctcggaaagccagatggagtcctgccggtcattccagactttccgcctg
taccgcgagtataaggaccacattctcgtgagggtcttcatggaatgtcaaaaaaggagc
ttggtcaaccggcgccgtgtcaaccacatgctgggcccaaagaaaaaccgggctctgccc
ttcgtgccgatgtcctaccagttgtcccagacctactacaggatttttatgtggagattt
ccaagcaccgtttgcacagaatcattccagtttttcagtaaaatcctggctgccggcaag
ttggaccagcctgataccttctccttcaaagacgaagataatagcaagtcttccaatgac
ctggtagcattttctctggatagccctggaggacactgtgtggccgccctgacgcttttc
tccttgggcctcatttccgtggatgtgcagatcccggaacagattgtcgtggtggacagc
tccatggtggagaacgaggtcatgaagagtttggggaaggacgggggcttagacgaggat
gacgatgaggaggaagacttggacgaaggctcggggggcaagcgccgggccatcgaggtg
aaagcccgccaggcttcccacaccaactacctgctgatgcggggctactgcgcaccaggc
atcgtcagcacccgcaacctcaaccccaacgacagcattgtggtgaactcctgccaggtg
aagttccggctccgccgcacccccacacccacccggctctggcccaccgtcccttgtctg
gaagagctgcccatgggcatctccagcctccctgactccttcaccaggctgattaagagc
caggaggatccctgcagcctggaagagtttgtccaccaggtggagctgtgcggctatgag
cctggagacgtgtgtgccgtcttggaagtccacggggtcattgcagccacagggtgcttt
ggggtggacagagtggagctgagcaaatggttctccgcctttgagaggacagatgctgag
cgcaccaggaccttcacggactacgtccaggatctcttggagcatcaccaggtcctggaa
gtaggtggcaacacaactcgcttggtggccatgggctctgcccggccctggctgttgcac
tcggtgcggccgaaaggcaaagaggaacatgtgtacccaccaagagaagacccccgggcc
cgaccccaagacaggcctgccagaaaggacagcccctctgagaggcactcccagggcccc
cagagcaccaaaaggcgtgccagctggacgagcagtgatgtggccagtcagggcagcggt
cctgaccctgagagcaccctgaagccccctgccaagaggcccacgctccaggatgtgcgc
ttggcccccagcccccggcccatagcagaagaggagccagaacccctggcgtctgctctg
ccggcagctcccagagacgcctatgtggaggagcttcccctgggagcaccagaagccggg
caggaggaccaagaggatactggggaacccaggcttccaggccaggagcagctgagctgt
caggaccagttcccagaaggatccgaagaccccagaggtttggccgagagttctgtggct
ggtagcgtctcccagacgacatgggaaaaggactgcgagagcatctcgttcatcgcccgc
ccgtggcgcatcgtggacggccacctgaacataccagtgtgcaagggcatgatggaggcc
ttgctctatcacatcatgagcaggcccggcattcccgagagctgcctgctgcagcactac
cagggcgtcctgcagcccgtcgccgtgctggagctgctccagggcctggaatccctaggc
tgcattaagaagtgctcgctgagaaggcccacagccgtctctctcttctccaagccccgg
gtcctggaggcccaggagccctccagcccgagcgagagccccaccgtgttctacgagccc
acgctggactgcaccctgcggctgggacgtgtgttcccccatgagatcaactggaacaag
tgggtccacttatga

DBGET integrated database retrieval system