KEGG   Canis lupus familiaris (dog): 489999
Entry
489999            CDS       T01007                                 

Gene name
MKL2
Definition
(RefSeq) MKL/myocardin-like protein 2 isoform X3
  KO
K22525  MKL/myocardin-like protein
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    489999 (MKL2)
SSDB
Motif
Pfam: RPEL SAP Angiomotin_C SAP_new25 DUF2130
Other DBs
NCBI-GeneID: 489999
NCBI-ProteinID: XP_005621582
Ensembl: ENSCAFG00000018810
VGNC: 43249
UniProt: E2QYE9
Position
6
AA seq 1081 aa
MIDSSKKQQQGFPEILTAGDFEPLKEKECLEGSNQKSLKEVLQLRLQQRRTREQLVDQGI
MPPLKSPAAFHEQIKSLERARTENFLKHKIRSRPDRSELVRMHILEETFAEPSLQATQMK
LKRARLADDLNEKIAQRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPQTQGDFSFDEDS
SDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFTPVSPAVPEFLKTPPTDQP
PTRSTAPVLPTNTVSSAKPGPALVKQSHPKNPNDKHRSKKCKEPKPRVKKLKYHQYIPPD
QKGEKSEPQMDSNYARLLQQQQLFLQLQILSQQQQHYNYQTILPAPLKPLNDKNSNTGNS
ALNNTTPNTPRQNTSAPVRKPGPLPSSLDDLKVSELKTELKLRGLPVSGTKPDLIERLKP
YQEINSSGVAAGSVLAVPASAIVTSNPEVTVALPVTTLHNSVTSSGSSFKAELPPTGTSN
IENVNSPLPISPSPSEQSSLGTEDTNMADTFTEIMTMMSPAQFLCSSPLRVTGSEDSPSP
TSSTLSSLELDAAEKDRKLQEKEKQIEELKRKLEQEQKLVEVLKMQLEVEKRGQRQPPPP
PPLEPQAGTPASSATKSDQKHGSVGSSVKDETSLSDCSSSRQPGPGASHSVGPPISTGGQ
TLVAKKAVVIKQEVPGAQAEQQSIVPQFYVSSQGQPPPTVVTPPQALLTTQTAQLLLPLS
IQGSGVTSVQLPVGSLKLQTPAQAGIQTQPQTATATLSSGLAQTVPQKQDTFTPHVLSQP
QQVRKVFTNSASNTVLPYQRAPTPGVQQPFVNKTPPSVLQSRNAPLPSLQNGPATSNKPA
SPPPPQQCVVQHSLFGSPVPKTKDPPRYEEAIKQTRSAQSSLPEISNAHSQQMDDLFDIL
IKSGEISLPIKEEPSPISKMRPVTASITTMPVNTVVSRPPPQVQMAPPISLEPMSSLSAS
LENQLEAFLDGTLPSTNEIVPLQSSSEDREPFSLIEDLQNDLLSHSSVLDHSHSPMETSE
AQFAASTPCLSLDLSDSNLDNMEWLDITMPNTSGLTPLSTTAPSMFSADFLDPQDLPLPW
D
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgatcgatagctccaagaagcagcaacagggcttcccagagattttaactgctggggat
ttcgaaccattaaaagaaaaggaatgccttgaggggagcaaccagaaaagtctcaaggaa
gtgctccagctgaggctgcagcagaggaggacaagagaacaactggtggaccagggcatc
atgccacctttgaagagcccagctgcattccatgagcagataaaaagcttggaacgagcc
agaactgaaaactttttgaagcataagattcggagccgaccagatcgttctgaacttgtc
aggatgcacattttagaagagacatttgcagagccatccctgcaggccactcagatgaaa
ttgaaaagagctcgactagctgatgatctgaatgagaagattgctcagagacctggtcct
atggagctagtagagaaaaacatccttcctgtggactccagtgttaaggaagcaattata
ggcgttgggaaggaggactatcctcagactcagggcgatttctcatttgatgaagacagc
agtgatgctttgtctccagaccagccagccagccaggagtcgcaggggtcagccgcgtcc
ccaagtgagccaaaagttagcgaatcgccgtctcctgtgaccacaaacactccagctcag
tttactccagtatccccagcagttcctgaattcttgaaaactcctcctacggatcagccc
cccaccaggtccacagctcctgttctccccaccaacactgtgtcctcagcaaagcctggg
ccagcactggtaaagcaaagccatcccaagaatcctaatgacaaacaccgcagcaaaaag
tgcaaagagcccaagccccgcgttaagaagctaaagtaccaccagtacattcctcccgac
cagaaaggtgagaagagcgagccgcagatggactccaactacgcccgcctgctccagcag
cagcagttgtttctacagctccagatcctgagccagcagcagcagcattacaactaccag
accatcctgccggcaccacttaagccactcaacgacaaaaatagcaacactgggaattca
gctctgaacaataccacaccgaacacaccaagacagaatacatctgctcctgtgaggaaa
ccaggacctctgccttctagcttggatgacttaaaggtatcagaactgaagacagaactg
aagttaaggggtcttccagtgtcgggcaccaaaccagacctcatcgaacgcctgaaaccc
taccaggaaataaacagtagtggcgttgctgccggcagtgtcctggctgtgccagcatct
gctatcgtcaccagtaacccagaagtcaccgtggcattgccggtaacaacactacacaac
tctgtgacaagctcgggctcctctttcaaggccgaattgccacccactggcaccagcaac
attgagaacgtcaattcccctctgcccatctcaccatccccctctgaacagtccagcctc
ggtactgaggacacaaacatggcagacactttcactgaaattatgaccatgatgtctcca
gcacagttcctgtgctcgtccccgctgagagtgacgggcagtgaagacagcccaagcccc
accagcagcacgctgtcaagtctggaactggacgcagctgagaaggaccgcaagctccag
gagaaggagaagcagatcgaggagctcaagaggaaactggaacaagagcagaagcttgtg
gaagttctgaaaatgcagcttgaagttgaaaagcgagggcagaggcagccgccaccgccg
ccacccctagaaccccaggccggcaccccagcctcttccgccaccaagtcagatcagaaa
catggcagcgttggttcctccgtcaaggatgagacctcactcagcgactgctccagctcc
aggcagcctggcccaggagccagccattctgtaggcccgcccatctcaacagggggccag
acccttgttgccaaaaaggctgtggtgatcaagcaggaggtccctggggcccaggcggag
cagcagagcatcgtcccgcagttttacgtgagttcccagggacagccgccgcctaccgtt
gtcactccgcctcaggctttactgaccacacaaactgctcagctgctgctgccactgtcc
atccagggctccggcgtcacctcagtgcagctccccgtaggcagcctcaaactccagact
ccagcacaagcaggaatccagactcagcctcagacagcaactgccaccctgtcctcaggc
ttagcccagactgtacctcagaaacaagatactttcacgccacatgtgctcagtcagcct
cagcaagttagaaaggttttcacaaactcggcatcgaatacagttctcccgtatcagaga
gcacccactccaggggtccagcagccctttgttaataagacgccccccagcgttctccag
tccagaaatgcaccacttccatccctgcagaacggacctgccacttccaataagcccgcc
tcaccaccgccaccccagcagtgtgtcgtccagcactccctgttcgggagcccagtcccc
aagacaaaagaccctccccgctatgaggaggccatcaagcagacgcgcagcgcccagtcc
tcccttcccgagatttcaaatgcacacagtcagcagatggacgacctctttgatatccta
attaagagtggggagatttccctccctataaaagaagagccttcgcctatttccaaaatg
agaccagtgactgccagcatcaccacaatgccagtcaacacagtggtgtcccgcccgcca
ccccaagtccaaatggcaccccccatctccttagaacccatgagcagtttatctgccagc
ctagagaaccagctagaagctttcttggatggaactttaccttcaaccaatgaaattgtt
ccactacaaagcagcagtgaagacagagagcccttctctctgatcgaggacctccagaat
gatctgctgagtcactcaagtgtgctggaccattcacactcacccatggagacttccgag
gcccagtttgctgcaagtactccctgtctgtcacttgacctttctgactcaaacttggac
aacatggagtggctggacattaccatgcctaacacgtcagggctcacccccctcagcaca
actgctcccagcatgttctccgctgactttctagatccacaagacctgccgttgccatgg
gactaa

DBGET integrated database retrieval system