KEGG   Canis familiaris (dog): 490049Help
Entry
490049            CDS       T01007                                 

Gene name
CLDN9
Definition
(RefSeq) claudin-9
  KO
K06087  claudin
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04514  Cell adhesion molecules (CAMs)
cfa04530  Tight junction
cfa04670  Leukocyte transendothelial migration
cfa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    490049 (CLDN9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    490049 (CLDN9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    490049 (CLDN9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    490049 (CLDN9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    490049 (CLDN9)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   490049 (CLDN9)
  Exosomal proteins of colorectal cancer cells
   490049 (CLDN9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF872
Motif
Other DBs
NCBI-GeneID: 490049
NCBI-ProteinID: XP_005621712
Ensembl: ENSCAFG00000024263
VGNC: 39323
UniProt: E2RBN4
Position
6
AA seq 217 aa AA seqDB search
MASTALELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT
AGVLLLLSGLLVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL
LCCTCPPPQMDRPRGPRLGYSIPSRSGASGLDKRDYV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaacagcccttgaactcctgggcatgaccctggccgtgctgggctggctgggc
accctggtgtcctgtgccctgcccctgtggaaggtgacggccttcatcggcaacagcatc
gtggtggcccaggtggtgtgggaggggctgtggatgtcctgcgtggtgcagagcacaggc
cagatgcagtgcaaggtgtacgactccctgctggcgctgccccaggacctgcaggctgcc
cgcgccctctgcgtcgtcgccctcctcttggccctgctcgggctgctcgtggccatcaca
ggggcccagtgcaccacctgcgtggaggatgaaggcgccaaggcccgaatcgtgctcacc
gcaggggtcctcctgctgctctccggcctcctggtgctcatccctgtctgctggaccgcg
cacgccatcatccaggacttctacaaccccctggtggccgaggccctcaagcgggagctg
ggggcctccctctacctgggctgggccgctgccgccctgctcatgctgggtgggggcctc
ctctgctgcacgtgccctccaccccagatggaccggccccgaggccccaggctgggttac
tccatcccctcccgttcaggggcatctgggctggacaagagggactacgtgtga

DBGET integrated database retrieval system