KEGG   Canis familiaris (dog): 490183Help
Entry
490183            CDS       T01007                                 

Gene name
BCL10
Definition
(RefSeq) B-cell lymphoma/leukemia 10
  KO
K07368  B-cell CLL/lymphoma 10
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04064  NF-kappa B signaling pathway
cfa04625  C-type lectin receptor signaling pathway
cfa04660  T cell receptor signaling pathway
cfa04662  B cell receptor signaling pathway
cfa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    490183 (BCL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    490183 (BCL10)
   04660 T cell receptor signaling pathway
    490183 (BCL10)
   04662 B cell receptor signaling pathway
    490183 (BCL10)
 09160 Human Diseases
  09167 Infectious diseases
   05152 Tuberculosis
    490183 (BCL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2 Flu_B_NS1
Motif
Other DBs
NCBI-GeneID: 490183
NCBI-ProteinID: XP_547304
Ensembl: ENSCAFG00000020285
UniProt: E2RA73
Position
6
AA seq 233 aa AA seqDB search
MEPAAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCS
SCEPFPDGATNNFSRSNSDESNFSEKLRASTVIYHPEGESSTAPFFSTESSLNLPVLEVG
RTENPTFSSTTLPRPGDPGAPPLPPELQLEDGGTCGNSSEMFLPLRSRAVSHQ
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgctgcgccgtccctcaccgaggaggacctgaccgaagtgaagaaggacgct
ttagaaaatctgcgtgtatacctgtgtgaaaaaatcatagctgagagacattttgatcac
ttacgtgcaaaaaaaatactcagtagagaagacactgaagaaatttcttgccgaacatca
agcaggaaaagggccggaaaattgttagactatttacaagaaaaccccaaaggactagat
acactggttgaatctattcggcgagaaaaaacacagaacttcctgattcagaagattaca
gatgaagtgctgaaacttagaaatataaaactagaacatctgaaaggactgaaatgtagc
agctgtgaaccttttccagatggagccacaaacaacttctctagatcaaattcagatgaa
agtaatttctctgaaaaactgagagcatccactgtcatataccatccagaaggagaatcc
agcacagccccttttttttctactgagtcttcactgaatttgcctgtcctagaagttggc
agaactgaaaatcccaccttctcttcaactacacttcccaggcctggggaccctggggct
cctcctttgccaccagagctgcagttagaagatggaggaacttgtggaaactctagtgag
atgtttcttcccttgaggtcacgtgctgtttcgcatcaatga

DBGET integrated database retrieval system