KEGG   Canis familiaris (dog): 490185Help
Entry
490185            CDS       T01007                                 

Gene name
MCOLN3
Definition
(RefSeq) mucolipin-3 isoform X1
  KO
K04994  mucolipin 3
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    490185 (MCOLN3)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   490185 (MCOLN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD_channel Ion_trans
Motif
Other DBs
NCBI-GeneID: 490185
NCBI-ProteinID: XP_005622045
Ensembl: ENSCAFG00000020297
UniProt: E2RLR6
Position
6
AA seq 553 aa AA seqDB search
MANPTVVISSCSSHEEENRCTFSQHTSPSEELLLEDQIRRKLKFFFMNPCEKFWARGRKP
WKLAIQILKIAMVTIQLVFFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQR
DVYDQIIFAVNQYLLLRNTSVGNHAYENKGTEQSAMAICQHFYKQGNICPGNDTFDIDPE
IETECFSVEPAEPFHVGTLEENKLNLTLDFHRLLTVDLQFKLKAINLQTIRHHELPDCYD
FTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYMMIFDAFVILTCLASL
TLCLRSVIRGLQLQQEFVNFFLLHYKKEVSVSDRMEFVNGWYIMIIISDMLTIIGSILKM
EIQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFQKYNLLILTLQAALPSVIRFCCCAA
MIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFATFAKMQQKSYLVWLFSRI
YLYSFISLFIYMILSLFIALITDTYETIKHYQQDGFPETELRTFISECKDLPNSGKYRLE
DDTPISIFCCCKK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcctacggttgttataagtagctgcagctctcatgaagaggaaaatcgttgc
acttttagccagcacacatcgccctctgaggagcttctgttagaagaccagataaggcga
aaactcaaattttttttcatgaatccttgtgaaaagttctgggctcgaggtagaaaacca
tggaagcttgccatacaaattctaaaaattgcaatggtgactatccagctggtctttttt
gggctaagtaaccagatggttgtagctttcaaggaagaaaacactatagcattcaaacac
ctcttcttaaaaggatatatggaccgaatggatgacacatatgcagtgtacacacaacgt
gatgtatatgatcagatcatctttgcagtgaaccagtacttgcttctacgcaatacctcg
gttgggaatcatgcttatgagaacaaggggacggaacagtctgctatggcaatctgtcag
cacttctacaagcagggaaacatctgtcctggaaatgataccttcgacattgatccagag
attgaaactgagtgtttctctgtagagccagctgagcctttccacgtcggaacactggaa
gaaaataaactcaacttaacgctggactttcacagactcctcacggtggacctgcagttt
aagctgaaggccattaatctgcagaccattcggcatcacgagctccctgactgttatgac
tttactctcactataacatttgacaataaggcccatagtggaagaattaagataagttta
gataatgatatttccatcagagaatgtaaagactggcatgtatcgggatcaattcagaag
aacactcactacatgatgatctttgatgcctttgttattctgacatgcttggcttcacta
accctgtgccttcgatctgtaattagaggacttcagcttcaacaggaatttgtcaatttt
ttcctcctccattataagaaggaagtttctgtttctgatcgaatggaatttgtcaatgga
tggtacattatgattattattagtgacatgttgacaattattggatcaattctgaaaatg
gaaattcaagctaagagtctaacaagttatgatgtttgtagcatacttcttgggacttcc
accatgcttgtgtggcttggagttattcgatacctcggcttctttcagaagtacaatctc
cttattctgaccctgcaggcagcactgcccagtgtcatcaggttctgttgctgtgccgct
atgatttatttaggctattgcttctgtggatggattgtgctggggccgtaccatgataag
ttccgttctctgaacatggtctctgagtgccttttctctctgataaatggagatgatatg
tttgccacatttgcaaaaatgcaacaaaaaagttacttggtctggctgtttagcagaatt
tatctctactcattcatcagcctctttatatatatgattttaagtcttttcatcgcactg
atcactgatacgtatgaaacaattaagcattaccaacaagatggctttccagagactgaa
cttcgtacatttatatcagagtgcaaagatctacccaattctggaaaatacagattagaa
gatgacactccaatatctatattctgctgttgtaaaaagtag

DBGET integrated database retrieval system