KEGG   Canis lupus familiaris (dog): 490334
Entry
490334            CDS       T01007                                 

Gene name
TNR
Definition
(RefSeq) tenascin-R
  KO
K06252  tenascin
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04151  PI3K-Akt signaling pathway
cfa04510  Focal adhesion
cfa04512  ECM-receptor interaction
cfa05165  Human papillomavirus infection
cfa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    490334 (TNR)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    490334 (TNR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    490334 (TNR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    490334 (TNR)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    490334 (TNR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    490334 (TNR)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   490334 (TNR)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_Tenascin EGF_2 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 490334
NCBI-ProteinID: XP_547454
Ensembl: ENSCAFG00000014301
VGNC: 47697
UniProt: J9NRI4
Position
7
AA seq 1358 aa
MGVDGETVVLKNMLIGVNLILLGSLLKPSECQLEVTTERVQGQAVEEEGGAASYNASGKE
QPVVFNHVYNINVPLDSLCSSGLEASAEQDVSAEDEALAQYTGQTSDRDSQVTFTHKINL
PKKACPCAGSARVLQELLNRIEMLEREVSLLRDQCTASCCPESAATGQLDYIPHCSGHGN
FSLQSCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCVCDSEYSGGDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCSELRCPGDCSGQGRCANGTCFCQEGYMGEDCSQRQCLNA
CSGRGHCQEGLCFCEDGYLGPDCSAVAPPEDLRVAGISDRSIELEWDRPMAVTEYVISYQ
PMALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LHFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQLPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWTPPRAKVDFILLKYGL
VGGEGGKTTFRLQPPLSQYSVQALRPGSRYEVWVSAVRGANESQSTTTQFTTEIDAPKNL
RVGSHTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHELLVPKSMGPTTRATLTDLVPGT
EYGVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISITAERGRQQSFESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMTEVSLDATKRHTVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVAPFDYYRVSYRP
TQVGRLDSSVVPNTVTEFTITKLYPATEYEISLNSVRGREESERICTLIHTAMDNPVDLT
ATNITPTEALLQWKAPVGEVENYVIILTHFAVAGETILVDGGSEEFQLVGLLPSTHYTVS
MYAASGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYILTYKSTDG
SRKELIVDAEDTWIRLEGLSESTDYTVLLQAAQDTARSSLTSATFTTGGRVFPHPQDCAQ
HLMNGDTLSGVYTIFLNGELSRKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWAEYRVG
FGNLEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFAYYDKFSVEDARSLYKLRLGGY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYNHRLPAGRKRRSLQF
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgggggtggacggggaaacggtggtcctgaagaacatgctcattggcgtcaaccttatc
ctcctgggctccctgctcaagccctccgagtgtcagctggaggtcaccaccgaaagggtc
cagggacaggcggtggaggaggaaggaggggcggccagctacaacgcctcgggcaaagag
cagccggtggtgttcaaccacgtgtacaacatcaacgtgcccctggacagcctctgctcc
tcggggctggaggcctcggccgagcaggacgtgagcgccgaagacgaggcgctggcgcag
tacacgggccagacgtccgaccgcgacagccaggtcaccttcacccacaagatcaacctc
cccaaaaaggcctgcccgtgcgccggctcggcccgggtgctgcaggagctgctgaatcgg
atcgagatgctggagagggaggtgtcgctgctgcgggaccagtgcaccgccagctgctgc
ccagaaagcgccgccacaggacaactggactacatccctcactgtagtggccacggcaac
tttagcctccagtcctgcggctgcatctgcaatgaaggctggttcggcaagaactgctcc
gagccctactgcccgctgggctgctccagccggggcgtgtgtgtggacggccagtgcgtc
tgtgacagcgagtacagcgggggcgactgctctgagctccggtgcccgacagactgcagc
tcccgggggctctgcgtagatggagagtgtgtctgtgaagagccctacacaggcgaggac
tgcagtgagctgaggtgccccggggactgttcggggcaggggagatgcgccaatggcacc
tgcttctgccaggagggctacatgggggaggactgcagtcaacggcagtgtctgaacgcc
tgcagcgggcgaggacactgccaggaggggctttgcttctgtgaagacggctacctgggc
cctgactgttcggcagttgcccctccagaggacttgcgagtggctggtatcagcgacagg
tccattgagctggaatgggacaggccgatggcagtgacggaatatgtgatctcttaccag
ccgatggccctggggggcctccagctccagcagcgggtacctggagattggagtggtgtc
accatcacggagctggagccaggtctcacctacaacatcagcgtctacgctgtcattagc
aacatcctcagccttcccatcactgccaaggtggccacccatctctccactcctcaaggg
ctacacttcaagacgatcacagagactaccgtggaagtgcagtgggagcccttttcattc
tcctttgatgggtgggagatcagcttcattccaaagaataatgaaggaggggtgattgct
cagctccccagtgatgttacatccttcaatcagacaggactaaagcctggggaggaatac
attgtcaatgtggtggctctgaaagagcaagcccggagcccccctacctcggccagcgtc
tctactgtcattgatggacccacacagatcctggttcgagatgtctcagacactgtggcc
ttcgtggagtggaccccacctcgagccaaagtcgatttcattctcttgaagtacggcttg
gtgggtggggaaggtgggaagaccaccttccggctacagcctcccctgagtcaatactca
gtgcaggccctacggccagggtcccgctatgaggtgtgggtcagcgctgtccgtggtgcc
aacgagagccagtccacgaccacccagttcaccacagagattgatgcccccaagaacctg
agagtgggctcccacacggcaaccagccttgacctcgagtgggacaacagcgaagcagag
gtccaggagtacaaagttgtgtatagcaccctggcgggtgagcagtaccatgagctgctg
gtccccaagagcatgggtcccaccacccgagccacactcacagatctggtgcctggcacg
gagtatggagttggaatatctgctgtcatgaactcacagcaaagtgtgccagccaccatg
aatgccaggactgaacttgacagtccccgggacctcatggtgactgcctcctcggaaacc
tccatctccctcatctggaccaaggccagtggccccattgatcactaccgaattaccttt
accccatcctccgggatcgcctcagaagtcactgtgcccaaggacaggacctcatacaca
ctgacagatctggagcctggagcagaatacatcatttcaatcactgctgagaggggtcgg
cagcaaagcttcgagtccactgtggatgccttcacaggcttccgccccatctcccatttg
cacttttctcatgtgacctcctccagtgtaaacataacctggagtgacccatcccctcca
gcagacagactcattctgaactacagccctcgcgatgaagaggaagagatgacagaggtc
tctctggatgctaccaagaggcatactgtcctgatgggtctgcagccagctactgagtac
attgtgaacctggtagcagtccacggaacagtgacctctgagcccatcgtgggctccatc
accacaggaattgatcctcccaaagacatcacaattagcaatgtgacgaaggactcagtt
atggtctcctggagccctcctgttgcaccttttgattactaccgagtatcatatcggcca
acacaagttggacgactggatagttcagtggtgcccaacacagtgacggaattcaccatc
accaaactgtatccagccactgagtatgaaatcagtctcaacagtgtgcggggcagggag
gagagtgagcgcatctgtaccctcattcacacagccatggacaaccctgtggatctgact
gctaccaacattactccaacagaagccctgctgcaatggaaggcaccagtgggtgaagtg
gagaactatgtcattattctcacacactttgcagttgctggggaaaccatcctggttgat
ggaggcagtgaggaattccagcttgttggcctgcttcctagcacccactatactgtcagc
atgtatgccgccagtgggcctctcaccagtggtaccatcagcaccaacttctctaccctc
ctggaccctcctgcaaacctgacagccagtgaagtcaccagacaaagtgccctgatctcc
tggcagcctcccagagcagagattgaaaactacatcttaacttacaaatccactgatgga
agccgcaaggagctgattgtggatgcagaggacacgtggatccgattggagggcctgtct
gagagcacagattacacagtgctcctgcaggcagcgcaggacaccgcccggagcagcctc
acctctgccaccttcaccacagggggccgagtgtttcctcatcctcaagactgtgcccag
catttgatgaatggagacactctgagtggggtttacaccatttttctcaatggagagcta
agccggaagttacaggtgtactgcgacatgaccacggatgggggtggatggattgtgttc
cagagacgacagaatggccaaactgactttttccggaaatgggctgagtaccgtgttggc
ttcgggaacctggaggatgagttttggctggggctggacaacatacacaggatcacatcc
cagggccgctacgagctgcgcgtggacatgcgggacggccaggaggctgccttcgcctac
tacgacaagttctccgtggaggatgctagaagcctgtacaagctgcgtctaggaggctac
aatggcactgcaggggactctctcagctatcatcaggggcgccctttctccacagaggac
agagacaatgatgttgctgttaccaactgcgccatgtcttacaagggggcctggtggtac
aagaactgccaccggaccaacctcaatgggaaatatggagagtccaggcacagtcagggg
atcaactggtaccactggaaaggccacgagttctccatccctttcgtggagatgaagatg
cgcccctataaccaccgtctcccagcggggcggaaacggcggtccttgcagttctga

DBGET integrated database retrieval system