KEGG   Canis lupus familiaris (dog): 490402
Entry
490402            CDS       T01007                                 
Symbol
ARHGEF11
Name
(RefSeq) rho guanine nucleotide exchange factor 11 isoform X1
  KO
K12331  Rho guanine nucleotide exchange factor 11
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04270  Vascular smooth muscle contraction
cfa04928  Parathyroid hormone synthesis, secretion and action
cfa05163  Human cytomegalovirus infection
cfa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    490402 (ARHGEF11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    490402 (ARHGEF11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    490402 (ARHGEF11)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    490402 (ARHGEF11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    490402 (ARHGEF11)
Membrane trafficking [BR:cfa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    490402 (ARHGEF11)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 PDZ_2 RGS Peptidase_M50 PH_13 PH
Other DBs
NCBI-GeneID: 490402
NCBI-ProteinID: XP_005622733
Ensembl: ENSCAFG00000016484
VGNC: 38074
Position
7:40499160..40585236
AA seq 1562 aa
MSVRLPQSIDRSASKKQSHLSSPIAAWLSTLSLGDPAPERRSPSHLRQPSDTSETAGLVQ
RCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEV
VKLIKSGAYVALTLLGSSPLSVGVSGLQQDPAPAGAPRVTPVVPPPPPPPPLPPPQRITG
PRPLQDPEFQKHATQILRNMLRQEEKELQRICEVYSRNPASPLEEQIEGARRRVTQLQLK
IQQEMGGFVDIPTLYSDTSQRASEGRLSLDSQEGDSGMDSGTERLPSLSEALMNRNSALS
DPGLDSPRTSPVIMARVAQHHRRQGSDAPGPSTSEQGTDQSPKPLIIGPEEDYDPGYFNN
ESDIVFQDLEKLKARPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQTNPKDSRGLGKDIW
NIFLEKNAPLRVKVPEMLQAEIDLRLRGSEDIRAALHEAQEAAMPEIQEQIQDYRTKRTL
GLGSLYGENDLLDLDGDPLRERHVAEKQLAALGDILSKYEEDRSAPMDFALNTYMNHAGL
RVRDARSSSLAEKAQAAPDKDKWLPFFPKTKKQSSNSKKDKDALEDKRRNPILKYIGKPK
SSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQPYDAPEPGTQRLSTGSFPEDLLESDSSR
SEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSL
ENPTPPFTPKMGRRSIESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDTQNWQHTVGKDV
VAGLSQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPE
LIEIHNSWCEAMRKLREEGPIIREIGDLMLARFDGPAREELQQVAAQFCSYQSIALGLIK
TKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESVLKHTEGGTSEHE
KLCRARDQCREILKYVNEAVKQTENQHRLEGYQKRLDTTSLERASNPLAAEFKSLDLTAR
RMVHEGPLTWRISKDKSLDLHVLLLEDLLVLLQKQDEKLMLKCHSKTAAGTSDNKQTFSP
VLKLNAVLIRSVATDKRAFFIICTSELGPPQIYELVALTSSDKNTWMELLEEAVRNATRH
PIAAPVLAHPPPPDAQEPAHQSPIPTRVGLDSSEVFHSEPESGLLPGGPGPQQRVRGKHP
GQLEDPEQESSIEEELGALPHPSASLDGESRGGRTRGPILLPLPGPLFMEGLADSALEDV
ERLRHLILCSLLPGHRSEAQPTSEPEDDLTPTPSLVSSACHTGDPSSPGRAPHGGEGPEQ
EDMALCSLERLPPRARNSGIWESPELDRNPEEEASGTEAAGSYKVVRKAEVVGSRAVTAL
PESQSGPEPPEVEGGAKAAGNCFYVSMPAGPPDSTTEPSQPNSLPVWQTEPEPQAQLQGG
SGGCRRPSRSPPSMALRDVGNIFHTIEQLTVKLNRLKDMELAHRELLRSLAGESSGGTTP
VGSFHTEAARWTDHSLSPPAREPLASDSRDSHQPGPCSEDGEGGSNTPLEDGTTHAASSP
GL
NT seq 4689 nt   +upstreamnt  +downstreamnt
atgagtgtgaggttgccccagagcatagacagatcagccagtaaaaagcagtctcacctg
tccagccccattgcagcctggttaagtaccctgtctttgggagatccagcgcctgaacgc
aggtccccttcccacctccgccagccctctgacacctctgagacagcaggtcttgttcag
cgctgtgtcatcatccaaaaggaccaacatggctttggcttcacggtcagcggggatcgc
atcgttctggtgcagtctgtgcggcctggaggggcagccatgagagctggtgtcaaagag
ggagaccggatcatcaaagtgaatggcaccatggtgaccaacagctcacacctggaggta
gtgaagcttatcaaatctggcgcctacgttgcactgaccctcctgggctcttcccccttg
tccgtcggtgtctctgggctgcagcaggaccctgccccagccggagccccccgagtcacc
cccgtggtcccaccacctccgccgccaccacctctgccccccccacagcgcatcacgggg
cccagacctctgcaggatcctgaattccagaaacatgccacccagatccttcggaatatg
ctgaggcaggaggaaaaggagttacagcgtatctgtgaggtgtacagccggaaccctgcc
agcccactggaggagcagatcgaaggtgcccggaggcgcgtcacgcagttacagctgaag
attcagcaggagatgggtggcttcgtggacatacccaccctatacagtgacaccagccag
agagcatcagaaggccgactctctctggattcccaggagggggacagtggcatggactct
gggacggaacgcctcccctccctcagtgaggcactgatgaatcggaactcggcactgtcg
gaccctgggctggacagtccccgaacctcgcctgttatcatggccagggtggcccagcac
caccggcggcagggctcggatgcaccagggcccagcaccagtgagcagggcacagaccag
agcccaaagcctttaatcattggtccagaggaagactacgacccgggttatttcaacaac
gagagcgacatcgtgttccaagaccttgagaagctgaaggcacggccagctcacctgggt
gttttcctgcggtatatcttctctcaggcagaccccagtccgctgcttttttacttgtgc
gcagaggtttatcagcagacaaaccccaaggattcccgaggcttaggaaaagacatctgg
aatattttcctggagaagaatgcgccactgagagtaaaggtcccagagatgctgcaagct
gaaattgacttgcgtctgcgcggcagtgaggacattcgcgctgccctccatgaagcccag
gaggcggccatgcctgagatccaggagcagatccaggactacagaacaaagcgcaccctg
gggctgggcagtctgtacggtgagaacgacctgctggacctggacggggaccctctccga
gaacgccatgtggctgagaagcagctggctgcgctgggagacatcctgtccaagtatgag
gaggacagaagcgcccccatggacttcgccctcaatacctacatgaaccatgccgggctc
cgtgtccgagatgcgcggtcttccagcctggctgaaaaggcccaggctgcacctgacaag
gacaagtggctgcccttcttcccaaagaccaagaagcagagtagcaactccaaaaaagac
aaggatgccttggaggacaagaggcggaacccgatcctcaagtacattgggaagcccaaa
agctcgtcgcagagcacatttcatattcccttgtcccctgtggaagtcaaaccaggcaac
gtgaggaacatcattcagcactttgagaacaaccagccgtatgatgccccagagcctggg
acgcagcggctctccacaggaagttttcctgaggacctgctggaaagtgacagctcccgc
tcagagattcgcttgggccgttccgagagcttgaagggtcgggaggagatgaagcggtct
cggaaggcagagaacgtgccccgctctcgcagcgacgtggacatggatgcagctgcagag
gcggcccgcctccatcagtccgcctcctcctctgcctccagcctctccaccaggtctctg
gagaacccaacccctcccttcacccccaaaatgggccgcaggagcattgagtcccccagc
ctgggcttctgcactgacgccctcctccctcacctcctggaggatgacttgggtcagctg
tctgacctagagcccgagcctgacacccagaactggcagcacacggtgggcaaggacgtg
gtggccggcctgagccagagggagatcgaccggcaggaggtcatcaacgagctatttgtg
acagaggcctcccatctgcgcacgctccgggtactggaccttatcttctaccagcggatg
aagaaggagaaccttatgcctcgggaggagctggcccggctcttccccaacctgcccgag
ctcatagagatccacaattcctggtgtgaggccatgaggaagctccgagaggagggccct
attatcagagagatcggagacctcatgctggctcggtttgatggccccgcccgggaggag
ctccagcaggtggccgcccagttctgctcctaccagtccatagccctgggactcatcaag
accaagcagcgcaaggagagccgctttcagctgttcatgcaggaagctgagagccaccct
cagtgccggcggctgcagctcagagacctcatcatctcggagatgcagcggctcaccaag
tatcccctgctgctggagagcgtcctcaagcacacagagggtggtacctctgagcatgag
aagctctgccgggctcgggatcagtgccgggaaattctcaagtacgtgaatgaagcagtg
aagcagacagagaaccagcaccggctagaaggctaccagaaacgcctggacaccacctcc
ctagagagggccagcaaccccttggcggcagagttcaagagcttggatcttacagctaga
aggatggtccatgaggggcccctgacctggaggatcagcaaggataagagcttggacctc
cacgtgctgctgctggaggacctcctggtgctgttgcagaagcaggatgagaaactgatg
ctcaagtgccacagcaagacagctgcgggcacctcggacaacaagcagaccttcagcccg
gtactcaagctcaatgctgtgctcatccgctctgtggccacagataaacgggcctttttc
atcatctgcacatcagagctgggccccccccagatctatgagctggtggcattgacgtcg
tcagacaagaacacatggatggagctcttggaggaggccgtgcggaacgccacccggcac
cccattgctgccccagtgctcgcccatcccccacccccagatgcccaggagccagcacac
cagagccccatacccaccagggtaggtctggacagctcagaggtgttccacagcgaacca
gaatccgggttgctgcctggaggccctgggccccagcagagggtcagggggaagcacccg
ggccagctagaggatcctgagcaggaaagcagcatagaggaggagctgggtgcccttcct
cacccctctgcatccctggatggagagagcaggggtggccggacacggggacccatcctc
ctgcccctcccaggccctctgttcatggaagggctcgccgactcagccctggaagatgtg
gagagactgcggcacctgatcctatgcagcctgctgcctggtcaccgctccgaagcacag
cccaccagtgagcccgaggatgacctgacacctacaccttctctcgtgagcagcgcctgt
cacactggggaccccagctctccaggacgagctccccatgggggtgaagggccagagcag
gaggacatggctctctgttctctggaacgcctgcccccacgggccaggaattctgggatc
tgggagtccccagagttggacaggaacccagaggaagaggcttcagggacagaggcagca
ggaagttacaaagttgtgagaaaagctgaggtggtgggcagcagggctgtcactgcgcta
ccagagagccagtcagggcctgagccgcccgaagtggaaggcggagccaaggctgcggga
aactgcttttatgtcagcatgccagcaggaccccccgactccaccactgagccctcccag
cccaacagcctccctgtctggcagacagaaccagaaccacaggcccagcttcagggaggc
agtggaggctgcaggcgccccagccgctccccacccagcatggccctcagggacgtgggc
aatatcttccacaccatcgagcaactcaccgtcaagcttaacaggctcaaggacatggag
cttgcccacagggagctgctcaggtcgcttgcaggagagtcgtccggtggcaccacacct
gtgggcagcttccacaccgaggcggccagatggacagaccactccctgtcacctccagcc
agggaacctctggcctctgactccagggacagccatcagccagggccatgctctgaggac
ggtgagggaggctccaatacccccctggaagatggcacaacacacgcagcctcatccccg
ggactgtag

DBGET integrated database retrieval system