KEGG   Canis lupus familiaris (dog): 490407
Entry
490407            CDS       T01007                                 

Gene name
MRPL24
Definition
(RefSeq) 39S ribosomal protein L24, mitochondrial
  KO
K02895  large subunit ribosomal protein L24
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    490407 (MRPL24)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cfa03011]
    490407 (MRPL24)
Ribosome [BR:cfa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    490407 (MRPL24)
  Bacteria
    490407 (MRPL24)
  Archaea
    490407 (MRPL24)
SSDB
Motif
Pfam: ribosomal_L24 KOW
Other DBs
NCBI-GeneID: 490407
NCBI-ProteinID: XP_547528
Ensembl: ENSCAFG00000016747
VGNC: 43387
UniProt: E2QS97
Position
7
AA seq 216 aa
MRLSALLALASKVTLPRDYRYGMSRPGSLADRRKNPPGTRRRRVAVEPISDEDWHLFCGD
TVEILEGKDAGKQGKVVQVIRQRNWVVLEGLNTHYRYVGKTAESRGTMIPSEAPLLHHQV
KLVDPVDRKPTEVEWRFTEAGERVRVSSRSGRIIPKPDFPRADGIVPETWTDGPKDTSVE
DALERTYVPRLKTLEEEVMEAMGIQETRRHKKVYWY
NT seq 651 nt   +upstreamnt  +downstreamnt
atgcgtctctctgccctgctggccttggcatccaaggtcactctgccccgagactaccgc
tatgggatgagccgcccaggctctctcgcagacaggaggaagaatcctccagggaccagg
cggcgccgggtggctgtggaacccatctctgatgaagactggcatctgttctgtggggac
acagtggagatcctagaaggcaaagatgctgggaagcaaggcaaagtggtgcaagtcatc
cggcagcgcaactgggtggtcctggagggcctgaatacacactaccgctatgttggcaag
accgccgagtcccggggaaccatgatccctagtgaagctcccttgcttcaccaccaggtc
aaattggtggatcccgtggacaggaagcccactgaggtggaatggaggttcacggaggcg
ggcgagcgggtacgtgtctcctcaagatcgggaagaattatccccaaacctgattttccc
agagctgacggcatcgtccctgaaacgtggactgatggccccaaagacacatcagtggaa
gatgctctcgaaagaacctatgtgccccgtttaaagacactggaggaagaggtgatggag
gccatggggatccaggagacgcgaagacacaagaaagtctactggtattga

DBGET integrated database retrieval system