KEGG   Canis familiaris (dog): 490439Help
Entry
490439            CDS       T01007                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1
  KO
K06279  SHC-transforming protein 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01521  EGFR tyrosine kinase inhibitor resistance
cfa01522  Endocrine resistance
cfa04012  ErbB signaling pathway
cfa04014  Ras signaling pathway
cfa04062  Chemokine signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04510  Focal adhesion
cfa04650  Natural killer cell mediated cytotoxicity
cfa04722  Neurotrophin signaling pathway
cfa04910  Insulin signaling pathway
cfa04915  Estrogen signaling pathway
cfa04917  Prolactin signaling pathway
cfa04926  Relaxin signaling pathway
cfa05034  Alcoholism
cfa05100  Bacterial invasion of epithelial cells
cfa05206  MicroRNAs in cancer
cfa05214  Glioma
cfa05220  Chronic myeloid leukemia
cfa05224  Breast cancer
cfa05225  Hepatocellular carcinoma
cfa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    490439 (SHC1)
   04012 ErbB signaling pathway
    490439 (SHC1)
   04072 Phospholipase D signaling pathway
    490439 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    490439 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    490439 (SHC1)
   04062 Chemokine signaling pathway
    490439 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    490439 (SHC1)
   04915 Estrogen signaling pathway
    490439 (SHC1)
   04917 Prolactin signaling pathway
    490439 (SHC1)
   04926 Relaxin signaling pathway
    490439 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    490439 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    490439 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    490439 (SHC1)
   05226 Gastric cancer
    490439 (SHC1)
   05214 Glioma
    490439 (SHC1)
   05220 Chronic myeloid leukemia
    490439 (SHC1)
   05224 Breast cancer
    490439 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    490439 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    490439 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    490439 (SHC1)
   01522 Endocrine resistance
    490439 (SHC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2 Delta_lysin
Motif
Other DBs
NCBI-GeneID: 490439
NCBI-ProteinID: XP_547561
Ensembl: ENSCAFG00000017156
VGNC: 46140
UniProt: F1PQC4
Position
7
AA seq 576 aa AA seqDB search
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDESPTTLCS
FFPRMSNLKLANPAGEPGRASKDGEGTGGAAVLDSAPLPLLQDMNKLSGGGGRRTRVEGG
QLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQV
TREAISLVCEAVPGAKGATRRRKPCSRPLSAILGRSNLKFAGMPITLTVSTSSLNLMAAD
CKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQA
FELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMR
LREAAPLGAVRPTPHVVQTPSHLGATLPVGQPVGGDPEIRKQMPPPPPCPGKELFDDPSY
VNVQNLDRARQAGGGAGPPNPAINGSVPRDLFDMKPFEDALRVPPPPQAVAMAEQLRGEP
WFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDH
RFESVSHLISYHVDNHLPIISAGSELCLQQPVERKL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaatccacttcggaatgagtctctgtcatcg
ctggaggaaggggcttcagggtccaccccaccggaggaactaccttccccatcggcctcc
tccctggggcccatcctgccacctctgcctggggatgagagtcccactaccctgtgctcc
ttcttcccccggatgagcaacctgaagctggctaacccagctggggagccaggaagggcc
tctaaggatggggaggggactggaggggccgccgtgctggactcagcccccctgcccctc
ctccaggacatgaacaagctgagtggaggaggcgggcgcaggacgcgggtggaagggggc
cagctggggggcgaggagtggacccgccacgggagcttcgtcaataagcccacacggggc
tggctacatcccaacgacaaagtcatgggacctggggtttcctacttggttcggtacatg
ggctgtgtggaggtcctgcagtcaatgcgtgccttggacttcaacacccgcacccaagtc
accagggaggccatcagtctggtgtgtgaggctgtgcccggtgccaagggggctacaaga
aggagaaagccctgtagccgcccactcagtgccatcctggggaggagtaatctgaaattt
gcgggaatgccaatcactctcaccgtctccaccagcagcctcaaccttatggccgcagac
tgcaaacagatcatcgccaaccaccacatgcagtctatctcctttgcgtccggtggggac
ccggacacagctgagtacgtcgcctatgttgccaaagacccggtgaatcagagagcctgt
catatcctggaatgtcccgaagggcttgctcaggatgtcatcagcaccatcggccaggcc
ttcgagttgcgcttcaaacaatacctcaggaacccgcccaagctggtcacccctcatgac
aggatggctggttttgacggctcagcttgggatgaggaggaggaagagccacctgaccac
cagtactataatgacttcccggggaaggagccccctcttgggggagtggtggacatgagg
cttcgggaagcagcccccctgggggctgttcggcccaccccacacgttgtccagaccccc
agccacctgggagcaacgctgcctgtggggcagcctgttgggggagacccagaaattcgc
aaacagatgccacctccaccaccctgcccaggtaaagagctctttgatgatccatcctac
gtcaatgtccagaacctagacagggcccggcaagcagggggtggggctgggccccccaat
cctgccatcaatggcagcgtgccccgagatctctttgatatgaagcccttcgaagatgcg
cttcgggtgcctccacctccccaggcggtggccatggctgagcagctccgaggggagccc
tggttccatgggaagctgagccggcgggaggccgaggccctgctgcagctcaatggggac
ttcctggtgcgggagagcacgaccacacccggccagtacgtgctcactggcttgcagagt
gggcagcccaagcacctgctgctggtggacccggagggtgtggttcgaacaaaggatcac
cgctttgagagtgtcagccacctcatcagctaccacgtggacaatcacttgcctatcatc
tctgcgggcagtgaactctgtctccaacagcctgtggagcggaagctgtga

DBGET integrated database retrieval system