KEGG   Canis lupus familiaris (dog): 490559
Entry
490559            CDS       T01007                                 

Gene name
CIDEA
Definition
(RefSeq) cell death activator CIDE-A
Organism
cfa  Canis lupus familiaris (dog)
SSDB
Motif
Pfam: CIDE-N GCV_T
Other DBs
NCBI-GeneID: 490559
NCBI-ProteinID: XP_547681
Ensembl: ENSCAFG00000018828
VGNC: 39271
UniProt: E2RQL5
Position
7
AA seq 219 aa
METARDYAGALFRPLTFMGSQTKRVLLTPLKHSARPFRVSNHDRSSRRGVMADSLKELLS
KTLEALVITSGLVTLVLEEDGTVVDTEDFFQTLGDNTHFMILEEGQKWTPGANYTPARQQ
PKKAGIARVTFDLYKLTPKDVIGCLNVKATMYEMYSVSYDIRCTGVKALLRSLLRLLSHA
AQVTGQLLIYTSSYMLRVLGDTEEQAPPKSCSRRGFTCR
NT seq 660 nt   +upstreamnt  +downstreamnt
atggagaccgcccgggactacgccggagccctcttcaggcccctgacatttatgggatca
cagaccaagagagtcctactaactcccctcaagcactcggctcgccccttccgggtctcc
aaccatgacagaagcagccgtcgaggggtgatggctgacagtctgaaggagcttctcagc
aagaccctggaggccttagttatcaccagcggactggtcactctggtgttggaggaagat
ggcactgtggtggatacggaagatttctttcagaccttaggagacaacacacatttcatg
atcttggaggaagggcagaagtggacaccgggtgccaactacaccccagctcgccagcaa
ccaaagaaggcaggaatagcaagagtcaccttcgacttgtacaagctgacccccaaggat
gtcattggctgcctcaacgtgaaggccaccatgtatgagatgtactcggtgtcctacgac
atccgctgtactggagtcaaagccctgctgaggagcctgctgcggctgctgtcccacgcc
gcccaggtgactggacagttgctcatctacaccagctcgtacatgctccgagtgcttggt
gacacggaagagcaggctcctcccaagtcctgctccagacgggggttcacatgcagatag

DBGET integrated database retrieval system