KEGG   Canis familiaris (dog): 490652Help
Entry
490652            CDS       T01007                                 

Gene name
INSM2
Definition
(RefSeq) insulinoma-associated protein 2
Organism
cfa  Canis familiaris (dog)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-C2H2_jaz zf-met zf-C2H2_6 zf-Di19 zf-H2C2_2 zf_C2H2_ZHX zf_UBZ
Motif
Other DBs
NCBI-GeneID: 490652
NCBI-ProteinID: XP_547774
Ensembl: ENSCAFG00000013428
VGNC: 42042
UniProt: E2R547
Position
8
AA seq 557 aa AA seqDB search
MPRGFLVKRTKRTGGSYRVRPAERVLPLLGPQGAPPFPEEPSSAPQPGAQQVAAPTLEQA
AAARDLSGSPCRAARVSPGEGGQEGDAAWRADGSGGPGPSPSPTKPAGAELRRAFLERCL
SSPVSAESFPGGAAAVAAFSCSAAPAAAPTSGEQFLLPIRAPFPEPELHPDPAPLAAALH
GLKRAAGNERRAKAPPGCTSGPAAAGVKKPKAMRKLSFADEVTTSPVLGLKIKEEEPGAP
SRGPGGSRTPLGEFICQLCKEQYADPFALAQHRCSRIVRVEYRCPECDKVFSCPANLASH
RRWHKPRPAAANAATVSSADGKPPPSSSSTSPDSGAVASFLAEGKEDSRAERAADQHLPA
RDSSREAQHQDSAPHQGLQVLSHPEPALPQVPCTEGVLGRRVPGSGSASGVGGPEVFMCP
YCHKKFRRQAYLRKHLGTHEAGSARALAPGFGSEHGAPPAFACPLCGAHFPSADIRDKHR
LWHALREELLLPALAGAPPEAPSPGGASDGSAQQIFSCKHCPSTFFSSPGLTRHINKCHP
SESRQVLLLQMPLRPGC
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggggcttcctggtaaagcgaactaaacggacgggcggctcctaccgagtgcgc
ccagctgagcgggtcttgcccctgctggggccccagggggcgccgcccttccccgaggag
ccttccagtgccccccagcccggtgcgcagcaggtggcagcccccaccttggagcaggcg
gcggcggcccgtgacctgtcggggtcgccctgtcgggcggctagggtgagcccgggggag
ggcgggcaggaaggtgatgcggcgtggagggcggatggcagcgggggtcccgggcccagc
cccagccccacgaagccggcgggcgcggagctgcgccgggcattcctggagcgctgcctc
agctcacccgtctctgcagagtccttccccgggggtgccgccgcggtggctgctttctcc
tgctcggcggcgccagcagctgcaccgacctcgggggagcagttcctgctgccgatccgg
gcaccgttcccagagccggagctccatccagaccctgcgcccctcgcggccgccctgcac
ggcctgaagcgggcagctggcaacgagcgccgtgccaaggcacctccgggctgcacgtct
ggacctgcggccgccggagtcaagaagccgaaggccatgaggaagttgagcttcgctgat
gaagtgaccacgtcccctgtcctgggcctgaagatcaaggaggaggagcccggagcgccg
tcccggggccccgggggcagccgcacgccgctgggggagtttatctgccagctatgcaag
gagcagtacgcagaccccttcgctctggctcagcaccgctgctcccgcatcgtacgcgtc
gagtaccgctgtcccgagtgcgacaaggtcttcagctgcccggcgaacctcgcctcccat
cgccgctggcacaaaccgcgtcccgcagcggcaaatgctgccacggtctcttcagccgac
gggaagccgcctccctcgtcttcctcgacctccccagactctggggctgttgcatctttc
ttggcggaggggaaggaggacagccgggcagagcgagcggcagatcagcacctgccggcg
agggacagctccagggaggcgcagcaccaggacagcgccccacaccagggcctccaggtg
ctgtcccatcccgagccggccctgcctcaggtcccctgcacggagggggtgttagggcgc
cgggtgcctgggtcaggtagtgccagtggtgtcgggggacccgaggtcttcatgtgccca
tattgccacaaaaagttccgtcgccaagcctatctgcgcaagcacctaggcactcacgag
gcaggctccgctcgtgcgcttgccccgggctttggctccgaacacggtgccccaccggcc
ttcgcttgcccactgtgcggggcgcacttcccgtccgcagacatcagggacaagcaccgg
ctgtggcacgcgctccgcgaggagctgctcctgcctgctctggccggggcgccccctgaa
gcgccgagcccaggcggagcgtccgacgggagtgctcagcaaattttctcgtgcaagcac
tgcccttccaccttttttagctccccggggctgacccggcacataaataagtgtcacccc
tcagaaagtcggcaggtactgctgctgcagatgccgttgcggcctggctgttga

DBGET integrated database retrieval system