KEGG   Canis lupus familiaris (dog): 490724
Entry
490724            CDS       T01007                                 

Gene name
KCNH5
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 5
  KO
K04908  potassium voltage-gated channel Eag-related subfamily H member 5
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    490724 (KCNH5)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   490724 (KCNH5)
SSDB
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS PAS_3 PAS_4 Cupin_2 NPV_P10 Cupin_3
Other DBs
NCBI-GeneID: 490724
NCBI-ProteinID: XP_547846
Ensembl: ENSCAFG00000032548
VGNC: 42250
UniProt: J9NRR1
Position
8
AA seq 988 aa
MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQ
KSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEK
VVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVVHKHSR
LAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKT
KQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSC
LPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVA
HWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYV
SSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNR
YHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHL
NRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQD
DEVVAILGKGDVFGDIFWKETTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSF
SRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTLSIPVDHPVRKLFQKFKQQKELR
NQGSTPSEPERNQLQVESRSLQNGASITGTSVVTVSQITPIQTSLAYVKASEALKQNNRD
AMELKPNGGADPKCLKVNSPIRMKNGNGRGWLRLKNNMGAHEEKKEDWNNVTKAESMGLL
SEDPKGSDSENSVTKNPLRKTDSCDSGITKSDLRLDKAGEARSPLEHSPIQADAKHPFYP
IPEQALQTTLQEVKHELKEDIQLLSCRMTALEKQVAEILKILSEKSVPQTSSPKSQMPLQ
VPPQIPCQDIFSVSRPESPESDKDEIHF
NT seq 2967 nt   +upstreamnt  +downstreamnt
atgccggggggcaagagagggctggtggcaccgcagaacacatttttggagaacatcgtc
aggcgctccagtgaatcgagtttcttactgggaaatgcccagattgtggattggcctgta
gtttatagtaatgacggtttttgcaaactctctggatatcatcgagctgacgtcatgcag
aaaagcagcacttgcagttttatgtatggagaattgactgacaagaagaccattgagaaa
gtcagacagacttttgacaactacgaatcaaactgctttgaagttcttctatacaagaaa
aacagaacccctgtttggttttatatgcaaattgcaccaataagaaatgaacatgaaaaa
gtagtcttgttcctatgtactttcaaggatattactttgttcaaacagccaatagaggat
gattcaacaaaaggttggacaaaatttgcccgattgacgcgggccttgacaaatagccga
agtgttttgcagcagcttacgccaatgaataaaacagaggtggtccacaaacattcaaga
ttagctgaagttcttcagctgggatcagatattcttcctcagtataagcaagaagcgcca
aagacgccaccacacattattttacactattgtgcttttaaaactacttgggactgggtg
attttaattcttaccttctacaccgccattatggttccttataatgtttccttcaaaacg
aagcagaacaacatagcctggctggtgctggacagtgtggtggacgttatttttctggtt
gacattgttttaaattttcacacgacctttgtgggacctggtggagaggtcatttctgac
cccaagctgataaggatgaactatctgaaaacttggtttgtgatcgatctattgtcttgt
ttaccttatgacatcatcaatgcctttgaaaatgtggatgagggaatcagcagtctcttc
agttctttaaaagtggtgcgtctcttgcgactgggccgtgttgctaggaaattggaccat
tatctagaatatggagcagcagtccttgtgctcctggtatgtgtgtttggactagttgcc
cactggctggcctgtatatggtacagcattggggactatgaggtcatcgatgaagtgacg
aacaccatccaaatagacagttggctctaccagctggccttgagcattgggactccatat
cgatataataccagtgcagggatatgggaaggaggacccagcaaggattctctgtacgtg
tcctctctctactttaccatgacaagccttacaaccataggatttggaaacatagctcct
actacagatgtggagaagatgttttcagtggccatgatgatggttggctctcttctttat
gcaactatttttggaaatgttaccacaattttccagcaaatgtatgccaacaccaaccga
taccatgagatgctgaataatgtgcgggactttctgaaactctatcaggtccccaaaggc
cttagtgaacgagtcatggattatattgtctcaacatggtccatgtcaaagggcattgac
acagagaaggttctctccatctgtcccaaggacatgagagctgatatctgtgttcatcta
aaccggaaggtttttaatgaacatcctgcttttcgattggccagcgacgggtgtctgcgg
gccttggcggtagagttccagactattcactgtgctcctggggacctcatttaccatgct
ggagaaagtgtggatgccctctgctttgtggtgtcaggatccttggaagtcatccaggat
gatgaggtggtggctattttagggaaaggtgatgtgtttggagacattttctggaaggaa
accacccttgctcacgcatgtgccaatgtccgagcactgacatactgtgacctccacatc
atcaagagagaagccttgctcaaagtcctggacttttatacagcttttgcaaactcattc
tcaaggaatctcactcttacttgcaatctgaggaaacggatcattttccgaaaaatcagt
gacgtgaagaaagaggaagaggagcgcctcaggcagaagaacgaggtcaccctcagcatc
cccgtggaccacccggtgcggaagctcttccagaagttcaagcagcagaaggagctgcgg
aaccagggctccacgccgagcgagcccgagcgcaaccagctccaggtagagagccgctcc
ctgcagaacggggcctccatcacgggcaccagcgtggtcaccgtgtcgcagatcacaccc
atccagacatccctggcctacgtgaaagccagtgaggccctcaagcagaacaaccgcgat
gccatggaactcaagcccaacggcggggctgaccccaaatgtctcaaggtcaacagcccg
ataaggatgaagaatggaaatgggagggggtggctgcgactcaagaataacatgggggcc
cacgaggagaaaaaggaagactggaataacgtcacgaaagcggagtccatggggctattg
tcagaggaccccaagggcagcgactccgagaacagcgttaccaaaaacccgttaaggaaa
acagattcttgcgacagcgggattacaaaaagtgaccttcgtttggataaggccggagag
gcccgaagtccgctagagcacagcccgattcaggcggatgccaagcaccccttttacccc
atcccagagcaggccttacaaaccacgctgcaggaagtcaagcacgaactcaaagaggac
attcagctgctaagctgcagaatgactgccctggaaaagcaggtggcagaaattttaaaa
atactctcggaaaaaagcgtgccccagacctcttctcccaaatcccaaatgccactccaa
gtacctccccagataccgtgtcaggatatttttagcgtttcaaggccggagtcacctgaa
tctgacaaagatgaaatccacttttaa

DBGET integrated database retrieval system