KEGG   Canis lupus familiaris (dog): 490744
Entry
490744            CDS       T01007                                 
Symbol
RDH12
Name
(RefSeq) retinol dehydrogenase 12 isoform X2
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00830  Retinol metabolism
cfa01100  Metabolic pathways
cfa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    490744 (RDH12)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     490744 (RDH12)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase AdoHcyase_NAD Pyr_redox_3 NAD_binding_10 DUF1776
Other DBs
NCBI-GeneID: 490744
NCBI-ProteinID: XP_005623616
Ensembl: ENSCAFG00000016446
VGNC: 52598
Position
8:41376188..41387256
AA seq 308 aa
MLAILGLLTSFLSFLKFFAGGVCRSNVQLPGKVVVITGANTGIGKETARELARRGARVYI
ACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGV
MMCPYSKTADGFETHLGVNHLGHFLLTHLLLERLKESTPARVVNLSSVAHHIGKIHFHDL
QGEKRYSRGFAYCHSKLANMLFTRELAKRLQGTGVTTYAVHPGVVSSELVRHSFLLCLLW
RIFSPFVKSAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARDNKTAERLWNVSC
ELLGIQWD
NT seq 927 nt   +upstreamnt  +downstreamnt
atgctggctatcttgggactgcttacctccttcctttctttcctgaagttctttgctggt
ggggtttgtagatcaaacgtgcagcttcctgggaaggtagtggtgatcaccggcgccaac
acgggcattggcaaggagacagccagagagctggctcgcagaggagcccgagtgtacatt
gcctgccgagacgtactgaagggggagtctgcagccagtgaaatccgagctgatacaaag
aactcccaggtgctggtgcggaaactggacctatctgataccaagtccatccgagccttt
gctgagggctttctggcagaggaaaagcagctccatattctgatcaacaatgcgggggtg
atgatgtgtccatattctaagacagctgatggctttgaaacccacctgggagtcaaccac
ctaggccactttcttctcactcacttgctcctggagcggctgaaggagtccacccctgca
cgggtggtaaacctgtcatcggtggctcaccacattggcaaaattcatttccatgacctc
cagggtgagaagcgctacagccgaggttttgcttattgccacagcaagctggccaatatg
ctttttactcgtgagctggccaagaggctccaaggcacgggggtcactacctatgctgtg
cacccaggcgtcgtcagctctgagctagtgcgacactccttcttgctgtgcctgctctgg
aggatcttctccccctttgtcaagtcggcacgggagggggcacagaccagcctgcactgt
gccctggctgagggtctggagcccctgagtggcaagtacttcagtgactgcaagagggcc
tgggtgtctccgagggcccgagataacaaaacggctgagcgcttatggaatgtcagctgt
gagcttctaggaatccagtgggattag

DBGET integrated database retrieval system