KEGG   Canis lupus familiaris (dog): 490748
Entry
490748            CDS       T01007                                 

Gene name
ZFP36L1
Definition
(RefSeq) mRNA decay activator protein ZFP36L1
  KO
K18753  butyrate response factor
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    490748 (ZFP36L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cfa03019]
    490748 (ZFP36L1)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     490748 (ZFP36L1)
SSDB
Motif
Pfam: Tis11B_N zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Other DBs
NCBI-GeneID: 490748
NCBI-ProteinID: XP_005623625
Ensembl: ENSCAFG00000016497
VGNC: 48613
UniProt: E2R2W0
Position
8
AA seq 338 aa
MTTTLVSATIFDLSEVLCKGNKMLNYNTPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSS
KFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGSGQVNSSRYKTELC
RPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAE
ERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGS
PTLPDGTNNPFAFSSQELASLFAPSVGLPGGGSPTTFLYRPVSESPHMFDSPPSPQDSLS
DQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaccaccaccctcgtgtctgccaccatcttcgacttgagcgaagttttatgcaagggt
aacaagatgctcaactacaatactcccagtgcagggggctgcctgctggacaggaaggcg
gtgggcacccccgccggtgggggcttcccccggaggcactcggtcaccctccccagctcc
aagttccaccagaaccagctcctcagcagcctcaagggcgagccggccccagctctgagc
tcccgcgacagccgcttccgagaccgctctttctccgaagggggcgagcggctgctgccc
acgcagaagcagccggggagcggccaggtcaactccagccgctacaagaccgagctgtgc
cgccccttcgaggagaacggcgcctgtaagtacggggacaagtgccagttcgcacacggc
atccacgagctccgaagtctgacccgccaccccaagtacaagacggagctgtgccgcacc
ttccacaccatcggcttttgcccctacgggccccgctgccacttcatccacaacgctgag
gagcgccgcgccctggctggggcccgggacctctccgccgaccgtccccgcctccagcat
agctttagctttgctgggtttcccagtgccgccgccaccgctgccgccacggggctgctg
gacagccccacgtccatcaccccaccccccatcctgagcgccgatgacctcttgggctca
cccaccctgcccgatggcaccaataaccccttcgccttctccagccaggagctggcgagc
ctctttgcccctagtgtggggctgcctgggggtggctccccaaccaccttcctctaccgg
cccgtgtccgagtccccccacatgtttgactctccccccagccctcaggattctctctcg
gaccaggagggctatctgagcagctccagcagcagccacagtggctcagattcccccacc
ttggacaactcaagacgcctgcccattttcagcagactttccatctcagatgactaa

DBGET integrated database retrieval system