KEGG   Canis familiaris (dog): 490939Help
Entry
490939            CDS       T01007                                 

Gene name
SLC4A1
Definition
(RefSeq) band 3 anion transport protein
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    490939 (SLC4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfa02000]
    490939 (SLC4A1)
   04147 Exosome [BR:cfa04147]
    490939 (SLC4A1)
   04090 CD molecules [BR:cfa04090]
    490939 (SLC4A1)
Transporters [BR:cfa02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   490939 (SLC4A1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   490939 (SLC4A1)
CD molecules [BR:cfa04090]
 Proteins
  490939 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Motif
Other DBs
NCBI-GeneID: 490939
NCBI-ProteinID: NP_001041496
Ensembl: ENSCAFG00000014228
VGNC: 49095
UniProt: Q2Z1P8
Position
9
AA seq 930 aa AA seqDB search
MDNQDSTMEKWQDDHEEGLEDTLEQEEYEDPYVPMVQVEEPVAYPTEPTATDEDTVTHPD
TTPRAGTHEIYVELHELVMDEKNQELQWMEAAHWVRLEENLGEDGVWGPPHLSYLTFWSL
LELQKAFVKGTVLLDLPETSLAGVANQLLDQFIYEEQIRPQDRDLLLRVLLLKHSHAGDL
EALGGVKPAVLMRSGDPSQPLLPQQPSLETQLFCKQGEGGTEDSPSRILEKIPPDSEATL
VLVGRAAFLERPVLGFVRLQMATELDAVGLPLPVRFLFVLLGPEAPNTDYTQLGRAVATL
MSERVFRTDAYLAQTKEELVRNLDCFLDCSLVLPPCEVPSEQALLSLVPVQKELLRRRYL
LSPAKPDPHFYKGLDLNGGPGGPGESDDPLQRTGLLFGGLVRDIRRRYPLYLSDITDAFS
PQVLAAVIFIYFAALSPAITFGGLLGEKTQNQMGVSELLISTAVQGILFSLLGAQPLLVV
GFSGPLLVFEEAFFSFCTSNNLEYIVGRVWIGFWLVLLVVLMVAFEGSFLVRFISRYTQE
IFSFLISLIFIYETFIKLIKIFQDHPLQRYYDYNMTIIPKPQGPLPNTALLSLVLMAGTF
FFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVMVDFFIKDTYTQKLSVPRGLSVSN
ASARGWVIHPLGLYSPFPIWMMFASVLPALLVFILIFLESQITTLIISKPERKMVKGSGF
HLDLLLVIGMGGVAALFGMPWLSATTVRSVTHANALTVMGKANIPGAAPQIQEVKEQRIS
GLLVAVLVGVSILMGPILSLIPLAVLFGIFLYMGVTSLSGIQLFDRVLLLFKPPKYHPDV
PYVKRVKTWRMHLFTVIQIICLAVLWTMKTFPTTSLTLPFILILTVPLRRLLLPLIFRKL
ELQCLDADDAKPTFNEEEGQDEYNEVHMPV
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccaggacagcaccatggaaaaatggcaggacgaccatgaagaggggctggag
gacactctggaacaggaggaatatgaggacccatatgtccccatggttcaggtggaggag
ccagtagcttaccccactgagccgacagccacagacgaagacaccgtaacacacccagac
accacaccacgcgcaggcacccacgagatctatgtggagttgcacgaactggtgatggat
gagaagaaccaggagttgcagtggatggaggcagcgcactgggtgcggctggaggagaac
ctgggggaggacggggtctggggccccccacacctgtcctacctcaccttctggagcctc
ctggagctgcagaaagccttcgtcaagggcactgtcctcctggatctgccagagacctcc
ctagcgggagtggccaaccagctgctggatcagtttatctacgaggagcagattcggcct
caggaccgagacctcctgctccgggtcctgctgctcaagcacagccacgccggagacctg
gaggccctgggcggtgtgaagcccgcggttctgatgcgttccggggacccctcacagcct
ctgctcccccagcaaccctcattagagacgcagctcttctgtaaacagggagaggggggc
acagaggattcaccatctagaattctggaaaagattcccccagattcggaggccaccctg
gtgctagtgggccgagcggcgttcctggagcgcccggtactgggcttcgtgcggctgcag
atggccacagagctggacgctgtggggctgcctctgcctgtacgcttcctcttcgtgttg
ctgggacccgaggcccccaacaccgactacacccagctgggtcgggctgttgccaccctc
atgtcggagcgggtgttccgcactgatgcctacctggcccagaccaaagaggagctagtc
cgcaacctggactgcttcctggactgcagccttgtgctgccgccctgcgaagtcccctca
gagcaggccctgctcagtctggtacccgtccagaaggagctgctgcggaggcgttacctg
ctcagccccgccaagccggacccccacttctacaagggcctagatttgaatgggggaccc
gggggccctggtgagtccgacgaccctctgcagcggacaggcctactctttgggggcctg
gtgcgtgacattcggcgccgctaccccctctacttgagtgacatcacagacgcgttcagc
ccccaggtcctggccgctgtcatattcatctactttgctgccctgtcacctgccatcacc
ttcggcggcctcctgggagaaaagacccagaaccagatgggggtgtcggagctgctcatc
tccaccgcggtgcagggcatcctcttctccctgctcggggctcagcccctgcttgtggtt
ggcttctcaggacccctgcttgtgtttgaagaagcctttttctcgttctgcactagtaac
aacctggagtacatcgtgggtcgtgtgtggatcggcttctggctcgtcctgctcgtggtg
cttatggttgctttcgagggcagcttcctagtccgcttcatctcccgctacacccaagag
atcttttccttcctcatctccctcatcttcatctatgagaccttcatcaagctgatcaag
atcttccaggaccatccactgcagaggtattatgactacaatatgacaatcatacccaaa
cctcagggtcccctgcccaacacagccctcctctctcttgtgcttatggctggcaccttc
ttcttcgccatgatgctgcgcaagttcaagaacagctcctacttccctggcaagctgcga
cgggtcattggggacttcggggttcccatctccattctgatcatggtcatggtggatttt
ttcatcaaggacacctacacccagaaactcagtgtgcctagaggcctttcagtgtccaac
gcctcagcccggggctgggtcatccacccactgggcttgtattcgcctttccccatctgg
atgatgtttgcctctgtcctgcctgccctgctggtcttcatcctcatcttcctggagtcc
cagatcaccacgctcattatcagcaaaccagagcgcaagatggtcaagggctctggcttc
cacctggacctgctgctggtcataggcatgggcggtgtggctgccctctttgggatgccc
tggctcagtgccaccaccgttcgttcagtcacccacgccaatgcgctcactgtcatgggc
aaggcgaacatcccgggagctgccccccagattcaggaggtcaaggagcagcggatcagt
gggcttctggtcgctgtgctcgtgggcgtgtccatcctcatggggcccatcctgtccctc
atccccctggctgtgctgtttggcatcttcctctacatgggggtcacgtccctcagcggc
atccagttatttgaccgcgtcttgcttctcttcaagccgcccaagtaccacccggatgtg
ccctacgtcaagcgggtaaagacctggcgcatgcacttattcacggtcatccagatcatc
tgcctggcagtgctgtggacaatgaaaaccttcccgaccacctccctgaccctgcccttc
atcctcatcctcactgtgcctctgcgccgcctcttgctgccactcatcttcaggaagctg
gagctccagtgtctggatgctgacgatgccaagccgaccttcaatgaagaggaaggtcag
gatgaatacaatgaggtgcacatgcccgtgtga

DBGET integrated database retrieval system