KEGG   Canis familiaris (dog): 490943Help
Entry
490943            CDS       T01007                                 

Gene name
NAGS
Definition
(RefSeq) N-acetylglutamate synthase, mitochondrial isoform X2
  KO
K11067  N-acetylglutamate synthase [EC:2.3.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00220  Arginine biosynthesis
cfa01100  Metabolic pathways
cfa01210  2-Oxocarboxylic acid metabolism
cfa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    490943 (NAGS)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     490943 (NAGS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAT AA_kinase
Motif
Other DBs
NCBI-GeneID: 490943
NCBI-ProteinID: XP_005624468
Ensembl: ENSCAFG00000014391
VGNC: 43611
Position
9
AA seq 476 aa AA seqDB search
MATARLAWALRATSAGGRLRGPRSTGDARRLSGSARRRAARGASPGRRLSTAWAPAQPVR
EGTEGAEDDTHAPAAEEPEWTPPPAPPVPPEPLEPPGPPAGRSLVQRDIQAFLNQCGASP
GEARHWLTQFQTCYHSADKPFAVIEVDEEVLKCSRAVSSLAFALAFLQRMDMKPLVVLGL
PAPTAPSGCLSFWEAKAQLAQHCKVLVDELRHNAATAVPFFGGGSVLGAAEPAPHASYGG
IVSVETDLLQWCLESGSIPILCPIGETTARRSVLLDSLEVTAALAKALQPTKIIFLNTTG
GLHDGTQKVLSNVNLPADLDLVTNAEWVSTKERQQMRLIVDVLSRLPHHSSAVITSASTL
LTELFSNKGSGTLFKNAERMLRVRSLDSLDQGRLVSLVNASFGKKLRDDYLASLRPRLHS
VYVSEGYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFCKPASDPGS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcgcggttggcctgggccctgcgggccacctctgcgggaggaaggctgcgc
ggtccccgaagcaccggggacgcccggagactgagcggcagcgcacgacggcgggcggcc
aggggcgccagcccggggcgccggctcagcaccgcctgggcgcccgcccagccggtacga
gaagggaccgagggcgccgaggacgacacccacgcgcctgccgcggaggagccggagtgg
acgccgccccccgcgcccccggtcccccccgagcccctcgagccccccgggcccccggca
ggccgctcgctggtgcagcgggacatccaggcctttctgaaccagtgcggagccagcccc
ggggaggcgcgccactggctcacgcagttccagacctgctaccactccgcggacaagccc
ttcgccgtcatcgaggtggacgaggaggtactcaagtgcagtcgggccgtatccagcctg
gccttcgccctggcattcctgcagcgcatggacatgaagccactagtagtcctcgggctg
ccggctcccacagcgccctccggctgcctttccttctgggaggccaaggcacaacttgcc
cagcactgcaaggtgctggtggatgagctgcggcacaacgctgccactgccgtgcctttt
tttggtggtgggtcggtgctgggagctgctgagccagcccctcatgccagctatggtggc
atcgtctcagtggagaccgacctgctacagtggtgcctggagtcgggcagcattcccatc
ttgtgccccatcggggagacgaccgcacgccgttcggtgctcctcgactcgctggaggtg
accgcggctctagccaaggcgctgcagcctaccaaaatcatcttcctcaataccaccgga
ggcctgcacgatggcactcaaaaggtcctgagtaatgtgaacctgcccgctgatctggac
ctggtgaccaacgccgagtgggtgagcaccaaggaacggcagcagatgcggctcattgtg
gatgtgctcagccgcctgccccaccactcctcggccgtcatcacctccgccagcacgctg
ctcaccgagctcttcagcaacaaggggtccgggaccctgttcaagaacgccgagcggatg
ctgcgggtgcgaagcctagacagcctggaccagggccgcctagtgagcctggtcaacgcc
agcttcggcaagaagctccgggatgactacttggcttcgctgcgcccccggctgcactca
gtctacgtctctgaggggtacttcaaacacagtgatggcagcttctccaacaagcagtgg
atcttcttctggtttggtctggccgatatccgggactcttacgagctggtcaaccacgcc
aagggactgccggactccttctgcaagccagcttctgacccaggcagctga

DBGET integrated database retrieval system