KEGG   Canis familiaris (dog): 491160Help
Entry
491160            CDS       T01007                                 

Gene name
NLK
Definition
(RefSeq) serine/threonine-protein kinase NLK
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04068  FoxO signaling pathway
cfa04310  Wnt signaling pathway
cfa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    491160 (NLK)
   04310 Wnt signaling pathway
    491160 (NLK)
   04068 FoxO signaling pathway
    491160 (NLK)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    491160 (NLK)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     491160 (NLK)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   491160 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 491160
NCBI-ProteinID: XP_868108
Ensembl: ENSCAFG00000018650
VGNC: 43841
UniProt: E2QWQ2
Position
9
AA seq 527 aa AA seqDB search
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaagagccaacgcaaaaatgatggcggcttataatggcggtaca
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttccacacctccctcct
cctcaccttcaccaccaccaccaccctcaacaccatcttcatccggggtcggctgcggct
gtacaccccgtacagcagcatacctcttcggcagctgccgcagccgcagcagcggccgca
gctgcagccatgttaaaccctgggcaacaacagccatatttcccatcacccgcaccgggt
caggctcctggaccagctgcagcagccccagctcaggtacaggctgccgcagctgctaca
gttaaggcgcaccaccatcaacactcgcatcatccacaacagcagctggatattgagccg
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcactcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agggtcttccgggaattgaagatgttgtgtttttttaaacatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgacctacataaaattatcgtctctcctcaaccactcagctcagatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcagctggcatt
ttacatcgagacattaagccagggaatctccttgtgaacagcaactgtgttctaaagatt
tgtgattttggattggccagagtggaggaattagatgaatcccgtcatatgactcaggaa
gttgttactcagtattatcgggctccagaaatcctgatgggcagtcgtcattacagcaat
gctattgacatctggtctgtcggatgtatctttgcagaactactaggacgaagaatactg
tttcaggcacaaagtcccattcagcagctggatttgattacggatcttttgggcacacca
tcgctggaagcaatgaggacagcttgtgaaggcgctaaggcgcacatactcaggggccct
cataaacagccatctcttcctgtactttataccctgtctagccaggctacacatgaagct
gttcatctcctttgcaggatgttggtctttgatccatccaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcgactacgatatcacacgtgtatgtgtaaa
tgttgcttttccacctctactggaagagtttataccagtgactttgagcccatcaccaat
cccaaatttgatgacacttttgagaagaacctcagttctgttcgacaggttaaagagatt
attcaccaattcattttggaacagcagaaaggaaacagagtgcctctctgcatcaacccg
cagtctgctgcttttaagagctttattagttccactgttgcccagccgtctgagatgccc
ccatctcctctggtgtgggagtga

DBGET integrated database retrieval system