KEGG   Canis familiaris (dog): 491265Help
Entry
491265            CDS       T01007                                 

Gene name
ABO
Definition
(RefSeq) histo-blood group ABO system transferase
  KO
K00709  histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    491265 (ABO)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     491265 (ABO)
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     491265 (ABO)
Glycosyltransferases [BR:cfa01003]
 Glycan extension
  ABO blood group
   491265 (ABO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_6
Motif
Other DBs
NCBI-GeneID: 491265
NCBI-ProteinID: NP_001271365
Ensembl: ENSCAFG00000019757
UniProt: F1PEJ9
Position
9
AA seq 353 aa AA seqDB search
MAGMRRAPAGKTKCCSLHTVTFLLVTLFLVLSGTGFRILGNSMLGSRQAGVGKRGELDGL
QAVEPSRMVYGQPKVLTPCRSDVLVLTPWLAPVVWEGTFNTDVLNEQFRLWNATIGLTVF
AIRKYMVFLELFLQTAEKYFMVGHRVTYYVFTDRPADVPHVPLREGRRVEVLKVPGALSW
QEVSMHRMEMISNFSQQRFLREVDYLVCMDVDMKFCDHVGVEILSPRFGTLHPGFYGAAR
EAFTYERRPQSQAYIPRDEGDFYYAGGFFGGSVVEVLQLTTACHQAMVVDQANGLEAVWH
DESHLNRYLLDHKPTKVLSPEYLWDRQKLGWPPVMKKLRFVAVPKGHLDIRGS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggccgggatgcggcgggcgccggcggggaaaacaaaatgctgctcacttcacacggtg
accttcctcctagtaacgctcttcttggtcctttctggcactggtttccggatcctggga
aactcgatgctagggagcaggcaagcaggggtaggcaagaggggggaactggatggcctg
caggccgtggaaccttccaggatggtttatggacagcccaaggtgctaacaccctgcagg
agcgatgtgttggtcctgaccccgtggctggcgcccgttgtctgggaagggaccttcaac
actgatgtcctgaacgagcagttccggctctggaacgccaccatcggactcaccgtgttt
gctatcagaaaatacatggtcttcctggagctgttcctgcagacggcagagaagtacttc
atggtgggacacagggtcacctactacgtcttcaccgaccggccggccgatgtgccccac
gtgcccctcagggagggccgcagggtggaggtcctcaaggttcccggcgccctgagctgg
caggaggtgtccatgcaccgcatggagatgatcagcaacttctcacagcagcgcttcctc
cgtgaggtggactacctggtgtgcatggatgtggacatgaagttctgcgatcacgtgggc
gtggagatcctgtccccccgcttcggcaccctgcaccccggtttctacggggcggcccgc
gaggccttcacctacgagcgccggccgcagtcccaggcctacattccgagagacgagggt
gacttttactatgcagggggctttttcggggggtcggtggtcgaggttctccagctgacc
acagcttgtcaccaggcgatggtggtggaccaggccaacgggctcgaggccgtgtggcac
gatgagagccacctgaacaggtacctgctggaccacaagcccaccaaggtgctgtcccca
gagtacctgtgggaccgacagaagctgggctggccccccgtcatgaagaagctgagattc
gtggctgtgcccaagggtcacctggacatccggggctcctga

DBGET integrated database retrieval system