KEGG   Canis familiaris (dog): 491396Help
Entry
491396            CDS       T01007                                 

Gene name
H2BFWT
Definition
(RefSeq) late histone H2B.L4
  KO
K11252  histone H2B
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05034  Alcoholism
cfa05203  Viral carcinogenesis
cfa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    491396 (H2BFWT)
  Immune diseases
   05322 Systemic lupus erythematosus
    491396 (H2BFWT)
  Substance dependence
   05034 Alcoholism
    491396 (H2BFWT)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    491396 (H2BFWT)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   491396 (H2BFWT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa TAF MCPsignal
Motif
Other DBs
NCBI-GeneID: 491396
NCBI-ProteinID: XP_013966933
Ensembl: ENSCAFG00000015167
UniProt: E2RH15
Position
X
AA seq 150 aa AA seqDB search
MAEPGCETSSEECLGTKEPREAEPETPKRKKPRRQCHRRCRRSRSDSFAIYFPRVLKQVD
EGLSLSQKAVSIMDSFVKDIFERIADEASRLARSTKRSTITSREIQTAVRLLLPGEIGKY
AVSEATKALMRNQVGALEKQVKNVLSLGCG
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcctggctgtgagacctcttcggaggaatgcctgggcactaaagagcccagg
gaagccgaaccagagaccccgaagaggaagaagccaaggcgtcaatgccaccgtcgctgc
cggcgcagccgctcagacagtttcgccatctacttccccagggttctgaagcaggttgac
gagggtctgagcctctcacagaaggctgtgagcatcatggattcgttcgttaaggacatc
ttcgagcgcatcgctgacgaggcctctcgcctggcccgctccaccaagcgctccaccatc
acctccagggagatccagaccgccgtacgcctgctgctgccgggggagattggcaagtac
gcggtgtctgaggccaccaaggccctcatgagaaatcaagtgggagcactagaaaaacaa
gttaaaaatgtactatccctgggctgtggatga

DBGET integrated database retrieval system