KEGG   Canis lupus familiaris (dog): 491743
Entry
491743            CDS       T01007                                 

Gene name
TLR7
Definition
(RefSeq) toll-like receptor 7
  KO
K05404  toll-like receptor 7
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04613  Neutrophil extracellular trap formation
cfa04620  Toll-like receptor signaling pathway
cfa05162  Measles
cfa05164  Influenza A
cfa05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    491743 (TLR7)
   04620 Toll-like receptor signaling pathway
    491743 (TLR7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    491743 (TLR7)
   05164 Influenza A
    491743 (TLR7)
   05162 Measles
    491743 (TLR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:cfa04054]
    491743 (TLR7)
Pattern recognition receptors [BR:cfa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   491743 (TLR7)
SSDB
Motif
Pfam: LRR_8 LRR_4 TIR LRR_5 LRR_12 TIR_2 LRR_9
Other DBs
NCBI-GeneID: 491743
NCBI-ProteinID: NP_001041589
Ensembl: ENSCAFG00000011698
UniProt: Q2L4T3
Position
X
AA seq 1050 aa
MVFPMWTLKRQFFILLNIILISKLLGARWFPKTLPCDVSLDAPKAHVIVDCTDKHLTEIP
GGIPSNATNLTLTINHIPGISPASFHQLDYLVEIDFRCNCIPVRLGPKDHLCTRRPQIKP
RSFSSLTYLKSLYLDGNQLLEIPEGLPPSLELLSLEANSIFSIMKYNLTELTNIERLYLG
QNCYFRNPCNVSFFIEKDAFLSLKNLKLLSLKDNNITYVPTTLPSTLTELYLYNNAIAKI
QEDDFNNLNQLRILDLSGNCPRCYNVPFPCTPCENNSPLQIHESAFDALTELQVLRLHSN
SLQRVPQRWFKNIKKLKELDLSQNFLAKEIGDAKFLYLLHDLVQLDLSFNYELQVYRAAL
NLSDAFSSLKNLKVLRIKGYVFKELSSHHLSPLQSLTNLEVLDLGTNFIKIADLSIFEQF
KTLKVIDLSMNKISPSGDSGEVGFCSSTRTSVEGHAPQVLETLHYFRYDEYARSCRFKNK
ETPSFLPFNKDCYMYGQTLDLSRNNIFFIKSSDFQHPSFLKCLNLSGNTIGQTLNGSEFQ
PLVELKYLDFSNNRLDLLYSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLK
KLMMNNNDIATSTSRTMESESLKILEFRGNHLDVLWRDGDNRYLKFFKNLLNLEELDISE
NSLSFLPSGVFDGMPPNLKTLSLVKNGLKSFHWERLQYLKNLETLDLSYNELKIVPERLY
NCSRSLKKLILKYNQIRQLTKHFLQDAFQLRYLDLSSNKIQIIQKTSFPENVLNNLEMLL
LHHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVVSLDLYTCELDLTN
LVLFSFSLSLALFLMVITTANHLYFWDVWYSYHYCKAKIKGYRRLKSLDSCYDAFVVYDT
KDPAVTEWVLDELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTN
KYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPLQKSKFLQLRKRLCKSSVLEWPRNP
QAHPYFWQCLKNALATDNHVTYSQVFKETV
NT seq 3153 nt   +upstreamnt  +downstreamnt
atggtgtttccaatgtggacattgaagagacagttctttatccttttgaacataatcctg
atttccaaactccttggagccagatggtttcctaaaactctgccctgtgatgtcagcctg
gatgctccgaaggcccatgtgattgtggactgcacggacaagcacctgacggaaatcccg
ggaggtattccctccaacgccaccaacctcaccctcaccattaaccacatacccggcatc
tctccagcctccttccaccagctggactatctggtagagatcgatttccgatgcaactgt
atacctgttcgactggggccgaaagaccatctgtgcaccaggaggccacagattaaaccc
agaagctttagcagcctcacttatttgaaatccctttatctggatggaaaccagcttcta
gaaatacccgagggtcttcctcccagcttggagctgctgagcctcgaagccaacagtatc
ttctctatcatgaaatataacctaacagaactgaccaacatagaaaggctctacttgggc
caaaactgttattttcgcaatccttgtaatgtttcatttttcatcgaaaaagatgctttc
ctaagtctgaaaaatctaaaattgctctccctcaaagataacaacatcacgtatgtccct
actactttgccgtctactttaacagaactctacctttataacaacgccattgcaaaaatc
caagaagatgattttaataacctcaatcaactgcgcatactcgacctaagtggaaattgc
cctcgttgttacaatgtcccatttccttgcacaccctgtgaaaataattcgcccctacag
atccatgagtcagctttcgatgcattgacagaattacaggtgttacgtctacacagtaac
tctcttcagcgtgtgccccagagatggtttaaaaacattaaaaagctcaaggagctcgat
ctgtcccaaaacttcttggccaaagaaattggggatgccaaatttttgtatcttcttcac
gaccttgtccaactggatctatctttcaattatgaacttcaggtctatcgtgcagctctg
aatctgtccgacgcgttttcttcactgaaaaacctgaaagtgttgcgcatcaaaggatac
gtctttaaggagctgagcagccatcatctctctccgttacagagccttaccaatctcgaa
gttcttgatctcggcactaacttcataaaaattgcggacctcagcatatttgaacaattt
aaaacactgaaagtcatagacctttcgatgaataagatatccccttcaggagattcaggt
gaagttggcttctgctctagcaccagaacctctgtcgaaggtcatgcgcctcaggtcctt
gagacattacattatttcagatatgacgagtatgcaaggagttgcaggttcaaaaacaaa
gagactccttctttcttgccttttaacaaagattgttacatgtatgggcagaccctggac
ctaagtagaaacaacatcttttttatcaagtcctctgattttcagcatccttctttcctc
aaatgcctaaatttgtcaggaaataccattggccaaactctcaatggcagtgaatttcag
ccactagtggagctgaaatacttggacttctctaacaaccggcttgatttactctactcg
acggcatttgaggagctacgcaaactggaagttctagatattagcagtaacagccattac
tttcaatcagaaggaatcactcacatgctaaacttcaccaagaacctaaaagttctgaag
aaactgatgatgaacaacaatgacatcgctacgtccaccagcaggaccatggagagtgag
tctcttaaaattctggaattcagaggaaatcatttggatgttttatggagagatggtgat
aacagatacttaaagttcttcaagaatctgctgaacttagaggaattagacatctctgaa
aattccctgagcttcttgccttctggagtgtttgatggcatgcctccgaatctaaagact
ctctccttggtcaaaaatgggctcaagtcctttcactgggaaagactccagtatctgaag
aatctagagactttggacctcagctacaatgagctgaagattgtccctgagagattatac
aactgttccagaagcctcaagaagctgattcttaagtataatcaaatcaggcagctgaca
aagcattttctacaagatgctttccagttgcgatatctggacctcagctcaaataaaatc
cagattatccagaagactagctttccagaaaatgtcctcaacaacctggagatgttactt
ttgcatcataaccggtttctgtgcacctgtgatgctgtgtggtttgtctggtgggtcaac
cacacagaggtgactattccttacttggccacagatgtgacttgtgtggggccaggagca
cacaagggccagagtgtggtctccctggatctgtatacctgtgagttagatctgactaac
ctggttctgttctcattttccctatcgctggccctttttctgatggtgattacaacagca
aaccacctctacttctgggacgtgtggtacagttaccattactgtaaggccaaaataaag
gggtatcggcgtctgaaatcactggactcttgctatgatgctttcgttgtgtatgacact
aaagacccagcagtgaccgaatgggttttggatgagctggtggccaagctggaagaccca
agggagaaacatttcaatttatgtcttgaggaaagggattggttaccagggcagccagtt
ctggaaaacctttcccagagcatacagcttagcaaaaagacggtgtttgtgatgacgaac
aagtatgcaaagaccgagaactttaagatagcattttacttgtcccatcagaggctcatg
gatgaaaaagtggacgtcattatcttgatattccttgagaagccccttcagaaatccaag
ttcctccagctccgcaagaggctctgtaagagttctgtcctggagtggccaagaaaccca
caggctcacccatacttctggcagtgcctgaaaaatgccctggccacagacaatcatgtg
acctacagccaggtgttcaaagagacggtctag

DBGET integrated database retrieval system