KEGG   Canis lupus familiaris (dog): 491859
Entry
491859            CDS       T01007                                 

Gene name
CFP
Definition
(RefSeq) properdin
  KO
K15412  complement factor properdin
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    491859 (CFP)
SSDB
Motif
Pfam: TSP_1 TSR TSP1_spondin TSP1_ADAMTS TSP1_CCN
Other DBs
NCBI-GeneID: 491859
NCBI-ProteinID: XP_548978
Ensembl: ENSCAFG00000015163
VGNC: 39179
UniProt: E2RH18
Position
X
AA seq 464 aa
MSTPGQAPQLLLLLLTLLPAKGSVPIWCFTQYEESSGKCQGFLGKGIRVEDCCLNPAYAF
QEPGSKLCQACRSPRWSPWSAWAPCSVTCTEGSQLRHRRCIGRGGQCPEKVEPGTLEWQL
QACEDQPCCPEMGGWSNWGPWTPCSVTCSKGTRTRQRICNQPTPKCGGQCPGKPQESETC
DTQQVCPVHGAWAVWGPWSACSGSCHGGPSAPAESRSRKCSAPEPSKVPPGKPCPGSERE
KRPCSGLPPCPVAGGWGAWGPVSPCPVTCGMGQTLEKRMCNHPAPQHGGPPCAGDAVRTH
ICNTAVPCPVNGEWGSWEEWSTCARRGINIMCKAIPGQQTRSRSCKGRKFDGQRCVGEQQ
DIRHCYNIQHCDWKGLWSEWSTWGLCVPPCGPMPIRTRQRLCMAQLPKFSPTITVVEGQG
EKNVTFWGKPSAQCETLQGQKVVVEETRPCLHVPACKDPQDEKP
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgtccaccccagggcaggctcctcagttgctactgctgctgctcaccctgctgccagcc
aaaggctcagtccccatatggtgcttcacccagtatgaggaatcttctggcaagtgccag
ggcttcctggggaaaggtatccgtgtggaagactgctgtctcaaccctgcctatgccttc
caggagcctggcagcaagctctgtcaggcatgcaggtccccacgatggtcaccgtggtct
gcgtgggccccctgctcggtgacctgcactgagggatcccaattgcggcaccggcgctgc
ataggccgtggtgggcagtgccctgagaaggtggagcccgggacccttgagtggcagctg
caagcctgtgaggaccagccgtgctgtcctgagatgggtggctggtccaactgggggccc
tggaccccttgctctgtcacctgttccaaagggacccggacccgtcagcgaatatgtaac
caacccacccccaagtgtggcggccagtgcccaggaaaaccacaggagtctgagacctgt
gacacccagcaggtctgccccgtacacggggcctgggctgtttggggcccctggagcgcc
tgctcgggttcctgccacggtggacccagcgcacctgccgagagtcgaagccgcaagtgt
tctgcacctgagccctccaaggtgcctcctgggaagccctgcccagggtcagaacgtgag
aagcggccctgctctggtctgccaccctgcccagtggctgggggctggggggcgtggggc
cctgtgagcccctgccctgtgacctgtggcatgggccagaccctggaaaaacggatgtgt
aatcaccctgcgccccagcatgggggccccccctgcgctggcgatgccgtccgaacccac
atctgcaatacagctgtgccctgccctgtgaatggagagtgggggtcctgggaggagtgg
agcacttgtgcccgtcggggcataaacatcatgtgtaaggcgatcccaggccagcagaca
cgctccaggagctgcaagggccgcaagtttgatggacagcggtgtgttggagaacaacaa
gatatccgtcactgttacaacattcaacactgtgactggaaaggcttatggtcagagtgg
agtacctggggtctgtgcgtacccccatgtggacccatgcccatccgcacccgccagcgc
ctctgcatggcccagctccccaagttctcgccaaccattactgtggtcgaaggtcagggt
gagaagaacgtgaccttctgggggaaaccttcagcacagtgcgagacgctgcaggggcag
aaggtggtggtggaggagactcggccatgtctacacgtgcctgcctgcaaagaccctcag
gatgagaagccctaa

DBGET integrated database retrieval system