KEGG   Canis lupus familiaris (dog): 491947
Entry
491947            CDS       T01007                                 
Symbol
NLGN3
Name
(RefSeq) neuroligin-3 isoform X1
  KO
K07378  neuroligin
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    491947 (NLGN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    491947 (NLGN3)
Membrane trafficking [BR:cfa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    491947 (NLGN3)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3
Other DBs
NCBI-GeneID: 491947
NCBI-ProteinID: XP_848852
Ensembl: ENSCAFG00000017010
VGNC: 43840
Position
X:46337800..46359510
AA seq 848 aa
MWLRLGLPSLFLSPESTVGRSLYLTLWFLSLVLRASTQAPAPTVNTHFGKLRGARVPLPS
EILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLP
VWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAKKQG
EDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSVLASYGNVIVITLNYRVG
VLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLS
HHSEGLFQRAIIQSGSALSSWAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKEL
VEQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDP
EDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTD
HQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTD
LFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRD
QLYLHIGLKPRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITR
RPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASLLF
LNVLAFAALYYRKDKRRQEPLRQPSPQRGAGAPELGAAPEEELAALQLGPTHHECEAAPP
HDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLP
HSHSTTRV
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgtggctgcggcttggcctgccctcgctgttcctgagccccgaatccacggttggccgg
agcctgtacctcaccctgtggttcctcagcttggtgctgagggccagtacccaggcccca
gcgcccacagtcaacacccactttgggaagctgaggggtgcccgggtacccttgcccagt
gagatcctggggcctgtggatcagtacctgggggtgccctacgcagctccccccatcggc
gagaaacgtttcctgccccctgagccacccccctcctggtcgggcatccggaacgccaca
cactttcccccagtgtgcccccagaacatccacacggctgtgcccgaagtcatgctgcct
gtctggttcactgccaacttggatattgtcgctacttacatccaggagcccaatgaagac
tgcctctacctgaatgtctatgtgcccacagaggatgtaaagcggatttccaaggaatgc
gcccgaaagcccaacaagaaaatttgtaggaaaggaggatccggcgctaagaaacagggc
gaggacttagcggataatgacggggatgaagatgaagacatccgggacagtggtgctaag
cccgtcatggtctacatccatggaggctcttacatggaagggacgggcaacatgattgat
ggcagtgtcctggccagttacggcaacgtcatcgtcatcaccctcaactatcgggttggg
gtactaggtttcctgagcaccggtgatcaggctgccaagggcaactatgggctccttgac
caaatccaggccctccgctgggtgagcgagaacattgccttctttggtggtgatccccgc
cgtatcactgtctttggctcaggcatcggtgcatcctgtgtgagcctcctcactctgtcg
catcactcagaggggcttttccagagggccatcatccaaagtggttctgctctgtccagc
tgggctgtgaactaccaaccagtgaagtataccagcctgctggcagacaaggtaggctgt
aacgtgctagacacagtggacatggtggactgtcttcgtcaaaagagtgccaaggagcta
gtagagcaggacatccagccagcccgctaccatgtggcctttggccctgtgatcgatggg
gacgtcattcctgatgaccccgagattctcatggagcagggcgagttcctcaactatgac
attatgctaggggtcaaccagggcgagggactcaagttcgtggaaggggtggttgaccct
gaggacggcgtctctggcaccgactttgactactcagtctccaactttgtggacaatcta
tatggctatcctgagggtaaggacaccctgcgggagaccatcaagttcatgtacacagac
tgggcagaccgtgacaatccggagacccgccgcaaaacactggtggcactcttcactgac
caccagtgggtggagccctcggtggtgaccgctgatctgcacgcccgctatggctcaccc
acctacttctatgccttctaccatcactgccagagcctcatgaagcctgcttggtcagat
gcagctcatggggacgaagtaccctatgtttttggtgtccctatggtaggccccactgac
ctcttcccctgtaatttctccaagaatgacgttatgctcagcgctgtcgtcatgacctac
tggaccaactttgccaagaccggggatccaaacaagccggtcccccaggataccaagttc
attcacaccaaggccaaccgctttgaggaagtggcctggtccaaatacaatccccgagac
caactctaccttcacatcgggctgaaaccaagggtccgcgatcattaccgggccactaag
gtggccttctggaaacatctggtgccccacctatacaacctgcatgacatgttccactat
acgtccacaaccaccaaagtgccgcccccggataccacccacagctcccacatcacccgc
aggcccaacggcaagacctggagcaccaagcgtccagccatctcccctgcctacagcaat
gagaatgcccaagggtcctggaatggggaccaggatgcagggccactcctggtggagaac
cctcgtgactactccactgaattaagtgtcaccatcgctgtgggggcctccctcctgttc
ctgaacgttctggcctttgctgccctctactaccgcaaggacaaacggcgtcaggagccc
ctgcggcagcctagccctcagaggggagccggggcccctgaattgggagctgctcctgag
gaggagctggcagcattacagctgggccccacccaccatgaatgtgaggctgcccccccc
catgacacactgcgcctcactgcactgcctgactacacgctgaccctgcgtcgctcccct
gatgacatcccactcatgacacccaacaccatcactatgattcccaactccttagtgggg
ctgcagacattgcacccctataacacctttgccgcagggttcaatagtactgggctgccc
cactcacactccaccacccgggtatag

DBGET integrated database retrieval system