KEGG   Canis lupus familiaris (dog): 492059
Entry
492059            CDS       T01007                                 

Gene name
IRS4
Definition
(RefSeq) insulin receptor substrate 4
  KO
K17446  insulin receptor substrate 4
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04022  cGMP-PKG signaling pathway
cfa04068  FoxO signaling pathway
cfa04140  Autophagy - animal
cfa04152  AMPK signaling pathway
cfa04211  Longevity regulating pathway
cfa04213  Longevity regulating pathway - multiple species
cfa04910  Insulin signaling pathway
cfa04920  Adipocytokine signaling pathway
cfa04923  Regulation of lipolysis in adipocytes
cfa04930  Type II diabetes mellitus
cfa04935  Growth hormone synthesis, secretion and action
cfa05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    492059 (IRS4)
   04022 cGMP-PKG signaling pathway
    492059 (IRS4)
   04152 AMPK signaling pathway
    492059 (IRS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    492059 (IRS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    492059 (IRS4)
   04923 Regulation of lipolysis in adipocytes
    492059 (IRS4)
   04920 Adipocytokine signaling pathway
    492059 (IRS4)
   04935 Growth hormone synthesis, secretion and action
    492059 (IRS4)
  09149 Aging
   04211 Longevity regulating pathway
    492059 (IRS4)
   04213 Longevity regulating pathway - multiple species
    492059 (IRS4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    492059 (IRS4)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    492059 (IRS4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cfa04990]
    492059 (IRS4)
Domain-containing proteins not elsewhere classified [BR:cfa04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   492059 (IRS4)
SSDB
Motif
Pfam: IRS PH_11 PH_8
Other DBs
NCBI-GeneID: 492059
NCBI-ProteinID: XP_005641715
VGNC: 42100
UniProt: E2RLU4
Position
X
AA seq 1275 aa
MASCSCARDQATRRLSAAAAATAAALAVVATTPLLPLGTSTALIGTGSSCPGAMWLSTAT
GSRSDSESDEEDLPVGDEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYENARKFRH
SVRAAAAAAAAAASGAAVPALIPPRRVITLYQCFSVSQRADARYRHLIALFTQDEYFAMV
AENESEQESWYLLLSRLILESKRRRCGTPGAQPDGEPTALAAAAAAEPPFYKDVWQVIVK
PRGLGHRKELSGVFRLCLTDEEVLFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRST
VIGPGELWMQVDDCVVAQNMHELFLEKMRALCADEYRARCRSYSISIGAHLLTLLSTRRH
LDTLPREPGGWLRRSRFEQFCHLRAIGDGEDEMLLARRYMTPSEPVLPSRRGRLHLPRAR
RSRRAISVPASLCRRLPPSPVRVPHPAEVPNDRACLSPEASGSGNSGDEGSPQGQEGQEG
NGGDYMPMNNWGSGNGRGSGGGQGASGQGSSSQSSGGNQCSGGGQGSGGGQDSSGGQGSG
GQGMGGNQRSGAGQGTAGGHGSGGGQGAGGGHGSGDGQGPGDGHGSRRGKNSGGGKGSGG
GKTSDGSGDRGKSLKKRSYFGKLTQSKQQQMPPPPPPPPPPPPAGATGGKGKSGGRFRLY
FCADRGAQKDRKEAKEVKDKADSPEGAARGPLRARAFDEDEDDPYVPMRPGVAAPLASSS
DYMPMAPQNFSASKHHSRSPFEDSRGYMMMFPRMSPPPAPSAQKEPDPEKEDESKDNDSE
SDYMFMAPGAGAIPKNPRNPQGGSSSKSWSSYFSLPNPFQGSPLGRSDHSEYVPMLPGKF
LGNSLDKAPTSNWGPKHAVSKPPVEGSFSKPRDGGTCWKPSDNGPPKNKAKRPNRLSFIT
KGNKIKPKSQKPTRAQREADSSSVYVNIDFTKSGSNMPAPFIQGLPGSWGIMAGPRPSAF
SHYVNVEFEVLFPHPAQNFSHLFRAIPGANPLFLEGARWPLVPLPPSATGGSASEEEGDY
IEVIFNPAMTPAVPFGDSAIRYDAETGRIYVVDPFSECCMDISLSPSRCSEPPPVARLLQ
EEQQLERRRPQDRSQSFFPSARAAVSAFPTDSLERDLPASLASAAAAAAASAAAPALALG
RALAAASALAAAPGIGAAARGLEAAAGFDSASVRWFQPVAGSAAAAAAAVRGTQAVAAGS
NPRARHPSADLAGGENWATAAVSPPPPPPPPRRPVPSPPEQQVSDNDDDDDDDDTYVRMD
FARPDNKKSDSPRRE
NT seq 3828 nt   +upstreamnt  +downstreamnt
atggcgagttgctcctgcgctcgcgaccaagcgaccaggaggctgagcgctgcagcggcg
gcaacagcggcagctctagctgtggtggcgaccaccccacttctccccttgggcacctcg
accgcactcattgggaccgggtcgtcttgtccgggagccatgtggctctccacggccact
ggctcccggtcagactcggagtccgacgaggaggacctccccgtcggggacgaagtctgc
aaacgcggctacctgcggaagcagaagcatgggcacaggcgctacttcgtgctcaaactc
gagaccgccgacgccccggctcggctggaatactacgaaaatgccaggaagttccggcac
agtgtccgcgccgcggcggctgcggctgcggcggccgcctctggagccgcggtccccgcg
ctcatcccgccgcgacgcgtgatcaccctgtaccagtgcttctccgtgagccagcgagcc
gatgccaggtaccgccacctcatcgccctcttcacccaggacgagtacttcgccatggtg
gccgagaacgagtcggagcaggagagctggtacttgctgctcagccgcctcatcctcgag
agcaagcgccgccgctgcggcacgcccggcgcgcagccggatggagagccgaccgcgctg
gcggctgcagcggcggcggagccacccttctacaaagatgtgtggcaggtaatagtcaag
cccagggggctggggcaccgaaaagagctgagcggcgtgttccggctttgtcttaccgac
gaggaggtgctgttcgtgaggctgaataccgaggtggccagcgtggtcgtccagctcctg
agcatccgtcgctgcgggcactcagagcagtacttcttcttggaggtcggtaggtccacc
gtcattggtcccggggagctctggatgcaggtcgatgactgtgtagtggcccaaaacatg
cacgagttgtttttggagaagatgagagccctgtgcgcagacgaatacagagcccgctgc
cgcagctacagcatcagcatcggcgcccacctgttaaccctgctgtccactaggaggcac
ctggacacgctgccgcgtgagcccggtggctggctgagaaggtcccgctttgagcagttt
tgccacctcagggccatcggggacggggaagacgagatgctcctcgccaggcgctacatg
acacccagcgaacctgtgctcccctccaggcgaggaagactgcacctgcccagagcgcgc
cgctccaggagagcgatttcggttccagccagcctttgccgccgcctcccgcccagcccg
gtgcgtgtcccgcatcccgccgaagtcccgaacgacagagcttgcctgtctcctgaagct
tctggctctggcaactctggggatgaagggagtcctcagggccaagagggacaggaagga
aacggaggtgactacatgcccatgaacaactggggctcgggaaatggccggggctccgga
ggtggccagggcgcaagtggccaaggctccagtagccagagttcagggggaaaccagtgc
tcaggtggggggcagggctctggaggtggccaggactctagcggtggccagggctcaggg
ggccagggtatgggaggaaaccaacgttcaggagctggccaaggcactgcaggtggacac
ggctctggcggcggccagggagccggaggtggacacggctcaggcgatgggcagggaccg
ggcgatggccatggctcccgccgtggcaagaactctggagggggcaaaggctcaggaggt
gggaagacttccgatggcagtggtgaccgtggaaaatctctgaagaaaagatcctacttt
ggcaaactaactcaaagcaagcagcagcagatgccaccacctccacctcctccaccccca
cccccaccagcgggagcaactggtggtaaagggaagtctgggggaaggttccgactttat
ttttgtgccgacagaggagcccagaaagatcgcaaggaggccaaagaggtcaaggacaag
gcagacagcccagaaggtgcagctcggggccccctcagagccagggcttttgatgaagat
gaggatgacccctatgtgccaatgaggccaggggtggctgcccctcttgcaagctctagc
gattatatgccaatggctccccaaaacttctctgcttcaaaacaccactctcgatcacct
ttcgaagattcaagggggtacatgatgatgtttcctaggatgagcccaccaccagcccca
agtgcccagaaagagccagatcccgagaaggaggatgagtcaaaggacaatgacagtgag
agtgactatatgtttatggctcctggagccggtgcaattccaaaaaaccccagaaatcct
cagggcggctcttcctctaaaagctggagctcctacttctctctgccaaatccttttcag
ggctccccattgggacggagtgaccacagtgagtatgtaccaatgttacctggaaaattc
ttgggaaatagcctggacaaggcacccacgtctaactggggccccaaacatgcagtttca
aagcctccagtcgaggggtcattctcaaagcctagggatggggggacatgctggaagcct
tcagataatgggccccccaagaacaaggccaaaagacccaaccgtctctcttttattaca
aaaggaaataaaatcaagcccaaatcacagaagcccacacgtgcgcagagagaagctgac
agctctagtgtctacgtcaacattgacttcactaaaagcgggagcaatatgccagccccc
tttattcaaggactgcccggttcatgggggatcatggctggccccagaccgtcagccttt
tctcactatgtgaacgttgagttcgaagtgctatttccacacccggcacaaaacttctcg
catcttttcagagctattccaggtgccaacccccttttcctggaaggtgctaggtggcca
ctcgtgcctcttcctcccagcgccacaggtggcagtgccagtgaggaagagggtgactac
atcgaagtgattttcaacccagcaatgacaccggccgtgcctttcggtgacagcgccatc
cgctatgacgcggaaacaggtcgaatctatgtggttgaccccttttccgagtgctgtatg
gacatttctctctcccccagccgctgctccgaaccgccacctgtagccaggctgctgcag
gaagaacaacagctggagcggaggcgcccgcaagaccgttcgcagagtttctttccgtcc
gcccgggcggcggtctcggctttccccaccgacagtctcgagagagacctccccgcctcc
cttgcctcggccgccgccgccgccgccgcctccgccgccgcgccggccttagctttgggc
cgggcgttagccgccgcctccgccctcgccgcggccccgggcatcggtgcagccgccagg
ggcttggaggccgctgctgggtttgactccgcctccgtccgctggttccaacctgttgca
ggctcggcagccgccgccgccgccgcggtgcgggggacccaagccgtggccgctggctcg
aacccgagagcccggcacccatctgcagacttggctggaggtgagaactgggccacagcg
gccgtctccccgccgccgccaccaccgccgcctcgccgcccggtgccgagtccccctgag
caacaggtttctgacaacgacgacgacgacgacgacgacgatacctacgtgagaatggac
tttgccagacctgacaacaagaagtctgactctccccgcagagagtga

DBGET integrated database retrieval system