KEGG   Canis lupus familiaris (dog): 492067
Entry
492067            CDS       T01007                                 

Gene name
PAK3
Definition
(RefSeq) serine/threonine-protein kinase PAK 3 isoform X1
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04012  ErbB signaling pathway
cfa04014  Ras signaling pathway
cfa04360  Axon guidance
cfa04510  Focal adhesion
cfa04660  T cell receptor signaling pathway
cfa04810  Regulation of actin cytoskeleton
cfa05132  Salmonella infection
cfa05170  Human immunodeficiency virus 1 infection
cfa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    492067 (PAK3)
   04014 Ras signaling pathway
    492067 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    492067 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    492067 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    492067 (PAK3)
  09158 Development and regeneration
   04360 Axon guidance
    492067 (PAK3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    492067 (PAK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    492067 (PAK3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    492067 (PAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    492067 (PAK3)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     492067 (PAK3)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: STE group
  STE20 family
   492067 (PAK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like Spt5_N APH DSHCT Ribosomal_60s Kdo
Other DBs
NCBI-GeneID: 492067
NCBI-ProteinID: XP_003435695
Ensembl: ENSCAFG00000018154
UniProt: E2REG4
Position
X
AA seq 583 aa
MSDSLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTNSPFQTSRPVTVASSQSEGKMPDLYGSQ
MCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGD
KSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDDNEPPPVIAPRPEHTKSIYTR
SVLESIASPAAPNKEATPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDP
KKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPN
IVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVI
HRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVD
IWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDV
DRRGSAKELLQVLLAGGNSLHNYAIISMAFATLMLYWSKPLCL
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgtctgacagtttggataatgaagagaaacctccagctcccccgctgagaatgaacagt
aacaaccgagattcttcggcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaggagaaagaacgcccagagatctctcttccttcagactttgaacatacgatt
catgtggggtttgacgcagtcaccggggagttcactaactcccccttccagacctctaga
cctgtgacggtcgcttcaagtcaatcagagggaaaaatgccagatctctatggctcacag
atgtgcccagggaagctcccagaggggatccctgagcagtgggcacggttactccaaacc
tccaacataacaaaactggaacagaagaagaacccacaagctgttctcgatgttctcaaa
ttctatgattccaaagaaacagtcaacaaccagaaatacatgagctttacatcaggagat
aaaagcgcacatggatacatagctgcccatccctcgagtacaaaaacagcatcagagccg
cctttggctcctcctgtgtctgaagaagaagatgaagaagaggaagaagaagaagatgac
aatgagcccccaccagtcattgcaccaagacctgagcatacaaaatcaatctacacccgc
tctgtgctggaatccatagcttcaccagcagcaccaaataaagaggccacaccaccttct
gctgagaacgccaattccagtactttgtatagaaacacagatcggcaacggaaaaaatcc
aagatgacagacgaggagatcctagaaaagctaagaagcattgtgagtgtcggtgaccca
aagaaaaaatacacaagatttgaaaaaataggtcaaggggcatcaggtactgtttacaca
gcgctagacattgccacaggacaagaggtggccataaagcagatgaaccttcaacagcag
cccaaaaaggaattaattattaatgaaattctggtcatgagggaaaataagaaccccaat
attgttaattatttagatagctacttagtgggtgacgaactatgggtagtcatggaatac
ttggctggtggctctctgactgatgtggtcacagagacctgcatggatgaaggccagata
gcagctgtctgcagagagtgcctccaagctttggattttttgcactcaaaccaagtgatc
catagagacataaagagtgacaatattcttcttgggatggatggctctgttaaattgact
gattttgggttctgtgcccagatcacccccgagcaaagtaaacggagcactatggtggga
actccctattggatggcacctgaggttgtaactcgaaaggcttatggtccgaaagtcgat
atctggtctctggggattatggcaattgaaatggtggaaggtgaacccccttaccttaat
gaaaatccactcagggcattatatctgatagccactaatggaaccccagagctccagaat
cctgagagactgtcagctgtgttccgtgactttttaaatcgctgtcttgagatggatgtg
gacaggcgaggatctgccaaggagcttttgcaggtgctcttggccggaggtaattctcta
cataactatgcaattatttccatggcatttgctactctaatgctttactggtcaaagccc
ctttgcttgtga

DBGET integrated database retrieval system