KEGG   Canis lupus familiaris (dog): 492111
Entry
492111            CDS       T01007                                 

Gene name
STAG2
Definition
(RefSeq) cohesin subunit SA-2 isoform X1
  KO
K06671  cohesin complex subunit SA-1/2
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    492111 (STAG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    492111 (STAG2)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    492111 (STAG2)
SSDB
Motif
Pfam: STAG Cnd3 AdoHcyase_NAD
Other DBs
NCBI-GeneID: 492111
NCBI-ProteinID: XP_005641835
Ensembl: ENSCAFG00000018587
VGNC: 46874
UniProt: E2RGR3
Position
X
AA seq 1268 aa
MIAAPEIPTDFNLLQESETHFSSDTDFEDIEGKNQKQGKGKTCKKGKKGPGEKGKGGNGG
GKPPSGPNRMNGHHQQNGVENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINF
FIQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIG
VLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSIN
MDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDA
IAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKEL
NSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSA
HRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAYL
VDSMWDCATELLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVG
RGTGKRVLTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIY
TTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDE
LADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSKWDLFACNYKLLKTGI
ENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQICQHYLTNVN
TTVKEQAFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDD
NNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDII
KETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTFG
LDQLKTREAIAMLHKDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYV
YLEKFMTFQMSLRREDVWLPLMSYRNSLLAGGDDDTMSVISGISSRGSTVRSKKSKPSTG
KRKVVEGMQLALTEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMS
VYPMQTEHHQTPLDYNTQVTWMLAQRQHEEARQQQERAALSYVKLRTNLQHAIRRGTSLM
EDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPPSKNRRERTELKPDFFDPASIMDE
SVLGVSMF
NT seq 3807 nt   +upstreamnt  +downstreamnt
atgatagcagctccagaaataccaactgattttaatctactacaggagtcagaaacacat
ttttcttctgacacagattttgaagacattgaaggaaaaaatcaaaagcaaggcaaagga
aaaacttgtaaaaaaggcaaaaagggcccaggagaaaagggcaagggtggaaatggagga
ggaaaacctccttctggtccaaaccgaatgaatggtcatcaccaacagaatggagttgaa
aacatgatgttgtttgaagttgttaaaatgggcaagagtgctatgcagtcggtggtagat
gattggatagaatcatacaagcatgaccgagatatagcacttcttgacctcatcaacttt
tttattcagtgttcaggctgtaaaggagttgtcacagcagaaatgtttagacatatgcag
aactctgaaataattcgaaaaatgactgaagagtttgacgaggatagtggagactaccca
cttaccatggctggtcctcagtggaagaagttcaaatccagcttttgtgaattcattggc
gtattagtacggcaatgtcaatatagtatcatatatgatgagtacatgatggatacagtt
atttcacttcttacaggattgtctgactcacaagtcagagcatttcgacatacgagcacc
ctggcagctatgaaattgatgaccgctttggtgaatgtggcactaaatcttagcattaat
atggataatacacaaagacagtatgaggcagaacggaataaaatgattggaaaacgagcc
aatgagaggctagaactcctgctacagaagcggaaagagcttcaggaaaatcaagatgaa
atagaaaatatgatgaatgcaatatttaagggagtgtttgtacatagataccgtgatgca
atagctgaaattcgagctatttgcattgaagaaattggcatttggatgaaaatgtatagt
gatgcctttctaaatgacagttatttaaaatatgttggctggactatgcatgataagcaa
ggtgaggtaagactcaaatgtctcactgctctacaagggctttattataacaaagaactt
aattccaaactggagctttttaccagtcggttcaaggatagaattgtgtctatgaccctt
gacaaagaatatgatgttgcagtacaagcaataaaattacttactcttgttttacagagt
agtgaagaagttcttactgcagaagattgtgaaaatgtctaccatttggtttattcagct
caccggccggtagcagtagcagctggggaatttctctacaaaaagctcttcagtcgtaga
gatccagaggaggatggaatgatgaaaagaaggggacgacaaggtccaaatgccaacctt
gttaagacattggtttttttctttctggaaagtgagttgcatgagcatgcagcatacctt
gtggatagcatgtgggactgtgctaccgagctactgaaagactgggaatgtatgaatagc
ttgttgctggaggagccacttagtggagaagaagcactaacagacagacaagagagtgct
ctgattgagataatgctttgtaccattagacaagcagctgaatgtcatcctcctgtggga
agagggacaggaaaaagggtgctgacagcaaaggagaagaagacccagttggatgacagg
acaaaaatcactgaactttttgctgtggcccttcctcagttattagctaagtactccgta
gatgcagaaaaggtgactaacttgttgcagttgcctcagtattttgatttggagatatat
accactggacgattagaaaagcatttggatgccttattacgacagatccggaatatcgta
gagaagcacacagatacagatgttttggaagcatgttctaaaacttaccatgcactctgt
aatgaagagttcacaatcttcaacagggtagatatttcaagaagtcaactgatagatgag
ttggcagataaatttaaccggcttcttgaagattttctgcaagagggcgaagaacctgat
gaagatgatgcatatcaggtattgtcaacattgaagagaatcactgcttttcataatgcc
catgatctttcaaagtgggatttgtttgcttgtaattacaaacttttgaaaaccggaatt
gaaaatggagacatgcctgagcagattgttattcatgcactgcagtgtactcactatgta
atcctttggcagcttgcaaagatcactgaaagcagctctacgaaggaggacttgctgcgt
ttaaagaaacagatgagggtattctgtcagatatgtcagcattacctgaccaacgtgaat
actactgttaaggaacaggctttcactattctctgtgatattctgatgatcttcagccat
caaattatgtcaggagggcgtgacatgttagaaccattagtttacacccctgattcttca
ttgcagtctgagttgctcagctttattctggatcatgtcttcattgaacaggatgatgat
aataacagtgcagatggtcagcaggaggatgaagccagtaaaattgaagctttgcacaag
aggagaaatttacttgcagcattttgtaagctaattgtatatactgtggtggagatgaat
acagctgcagatatcttcaagcagtatatgaagtattataatgactatggagatatcatc
aaggaaaccatgagtaaaacaaggcagatagacaaaattcaatgtgcaaagacccttatt
ctcagtttgcaacagctttttaatgaaatgatacaggaaaacggctataattttgataga
tcatcctcaacatttagcggcataaaagagcttgctcgacgttttgctttaacttttgga
cttgatcaattgaaaacaagagaggccattgctatgctacacaaagatggcatagaattt
gcttttaaagagcctaacccacaaggagagagccatccacctttaaatttggcatttctt
gatatcctgagtgaattttcttctaaactactccgacaagacaaaagaacggtgtatgtt
tacttggaaaagttcatgacctttcagatgtcactccgaagagaagatgtgtggcttcca
ctgatgtcttaccgaaattctttgctagctggtggtgatgatgacaccatgtcagtcatt
agtggaatcagcagtcgggggtcaactgtgcggagtaaaaaatcaaaaccatctacagga
aaacggaaagtagttgagggcatgcaacttgcactcactgaagaaagcagtagtagtgac
agtatgtggttaagcagagaacaaacactgcacaccccagttatgatgcagacgccacaa
ctcacctcaacgattatgagagagcccaaaagattacgacctgaggatagcttcatgagt
gtctatccaatgcagactgaacatcatcaaactcctcttgattataacacgcaggtaaca
tggatgttagctcaaagacaacacgaggaagcaaggcaacagcaggagagagcagcattg
agctatgttaaactgcgaactaatcttcagcatgccattcgacgtggtacaagcctaatg
gaagatgatgaagagccgattgttgaagatgttatgatgtcctcagaagggaggattgaa
gatcttaacgaaggaatggattttgacaccatggatatagacttgccaccatcaaagaac
agacgagaaagaacagaactgaaacctgatttctttgatccagcttcaattatggatgaa
tcagttcttggggtgtcaatgttttaa

DBGET integrated database retrieval system