KEGG   Canis familiaris (dog): 492220
Entry
492220            CDS       T01007                                 

Gene name
GABRE
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit epsilon
  KO
K05185  gamma-aminobutyric acid receptor subunit epsilon
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04080  Neuroactive ligand-receptor interaction
cfa04723  Retrograde endocannabinoid signaling
cfa04727  GABAergic synapse
cfa05032  Morphine addiction
cfa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    492220 (GABRE)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    492220 (GABRE)
   04723 Retrograde endocannabinoid signaling
    492220 (GABRE)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    492220 (GABRE)
   05033 Nicotine addiction
    492220 (GABRE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    492220 (GABRE)
Ion channels [BR:cfa04040]
 Ligand-gated channels
  GABA-A
   492220 (GABRE)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb C5-epim_C
Other DBs
NCBI-GeneID: 492220
NCBI-ProteinID: XP_549340
Ensembl: ENSCAFG00000019156
VGNC: 41062
UniProt: E2QVM5
Position
X
AA seq 488 aa
MLAKVLLILLGTSIILPSRSEGPHVESKSAPSARDDVYGPQPQAPEEKLLSEETKSTMRL
GNLPAATHILNSILNNYDHKLRPGIGERPTVVTVELSVNTLGPISIMDMEYTIDITFCQT
WYDERLRYNGSFESFVLNGNMVSQLWIPDTVFRNSKRTQEHVITMPNQMVRIHKDGKVLY
TIRMTIDAGCLLYMLKFPMDSHSCPLSFSSFSYPESEMIYKWENFKLQIDERNTWKLFQF
DFTGVTNTTETISTPAGDFTVMTLYFNVSRRFGFVAFQNYVPSSVTTMLSWVSFWIKRDS
APARTSLGITSVLTMTTLGTFSRKNFPRVSYITALDFYIAICFVFCFCALMEFAVLNFLT
YNRTNPRASPKLRHPQIRARSRTPPRAHVHQHPEAFVCQIEDSEESDEEEGPSCPAQQSL
SLDTTQRPGGCCKWCKKYFCMVPSCEGSIWQKGRLFIHIYRLDNYSRVIFPVTFFFFNVL
YWLVCLNL
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgttagccaaagttctcctgatcctcctgggcacgtccataatcctcccgtctaggagc
gaaggacctcatgttgaatcaaaaagtgcaccctctgcccgtgatgatgtgtatgggcct
cagccccaggctcctgaagagaagctcctctctgaagaaacaaagtccaccatgaggctt
ggcaatctgccagcagccactcacatcctgaacagtatcctgaataattatgaccacaaa
ctgcgccctggcataggtgaaaggcccactgtggtcactgtcgagctctctgtcaatacc
cttggccctatctctatcatggacatggaatacaccattgacatcaccttctgccagacc
tggtatgatgaacgcctccgttacaatggcagctttgagagctttgttctgaatggaaac
atggtgagccagctttggatcccagacacagtctttaggaattctaagaggactcaagag
catgtgatcaccatgccgaaccagatggttcgcatccacaaggatggcaaggtgttgtac
acaattaggatgaccattgatgctggatgtttactctacatgctcaaatttccaatggat
tctcactcttgccctctgtctttctctagcttttcctatcctgagagtgaaatgatctac
aaatgggaaaatttcaagcttcagatcgatgagaggaatacctggaagctctttcagttt
gattttacaggagtgaccaacactactgaaactatctcaaccccagctggtgatttcacg
gtcatgacactttacttcaatgtgagcaggcggtttggctttgtagcctttcaaaactac
gtcccttcttctgtgaccacaatgctctcctgggtttccttttggatcaagagagactct
gctccagccagaacctctttagggataacctctgtactcactatgaccaccttgggcacc
ttttcccgtaagaatttcccacgtgtctcctacatcacagccctggatttctatattgcc
atctgtttcgtcttctgcttctgtgctctgatggagtttgctgtgctcaacttcctgact
tacaaccggacaaatccccgtgcttctccaaaacttcgccatccacagattcgtgcccgc
tcccgtacccctccccgtgcccatgtccaccagcatccagaagcttttgtgtgccagatc
gaggactctgaggaaagtgatgaagaggagggcccatcttgcccagcccagcagtctctt
agcctagataccacccagaggcctggtggttgctgcaagtggtgcaagaagtatttttgt
atggtccccagttgtgagggtagcatctggcagaagggccgcctcttcatccacatctac
cgcctggataactactcacgagttatttttcctgtgaccttcttcttcttcaatgtgctc
tactggcttgtttgccttaacttgtag

DBGET integrated database retrieval system