KEGG   Canis familiaris (dog): 606852Help
Entry
606852            CDS       T01007                                 

Gene name
DDC
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00350  Tyrosine metabolism
cfa00360  Phenylalanine metabolism
cfa00380  Tryptophan metabolism
cfa01100  Metabolic pathways
cfa04726  Serotonergic synapse
cfa04728  Dopaminergic synapse
cfa05030  Cocaine addiction
cfa05031  Amphetamine addiction
cfa05034  Alcoholism
Module
cfa_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
cfa_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    606852 (DDC)
   00360 Phenylalanine metabolism
    606852 (DDC)
   00380 Tryptophan metabolism
    606852 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    606852 (DDC)
   04726 Serotonergic synapse
    606852 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    606852 (DDC)
   05031 Amphetamine addiction
    606852 (DDC)
   05034 Alcoholism
    606852 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    606852 (DDC)
Enzymes [BR:cfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     606852 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     606852 (DDC)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   606852 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 606852
NCBI-ProteinID: XP_022260862
Ensembl: ENSCAFG00000003400
VGNC: 39831
Position
18
AA seq 485 aa AA seqDB search
MDSAEFRRRGKEMVDFVADYLEGIEGRQVYPDVEPGYLRPLIPTTAPEEPDMFEDIISDV
EKIIMPGVTHWHSPFFFAYFPSANSYPALLADILCGAIGCIGFSWAASPACTELETVMMD
WLGKMLKLPEAFLAGQVGEGGGVIQGSASEATLVALLAARTKVTRRLQAASPGLTQGAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGKFAMRASALQEALERDKAEGLIPFFVV
ATLGTTSCCSFDNLLEVGPICNKEDMWLHIDAAYAGSSFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLIGAFKLDPLYLKHNHQDSGLITDYRHWQLPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKFSPLQHVRLAHEFERLVQQDPRFEICTEVTLGLVCFRLKG
SNRLNEELLERINSAKKIHLVPCHLRDKFVLRFAICARTVESAHVQLAWKHVAQLATSLL
ATPRD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggactcagctgaattccgaaggaggggcaaggagatggtggacttcgtggccgactac
ctggaaggcatcgaggggcgccaggtgtacccggatgtggagcccggctacctgcggccc
ctcatccccaccactgcacccgaggagccagacatgtttgaggacatcatcagtgacgtg
gagaagataatcatgccaggggtgacccactggcacagccccttcttcttcgcctacttc
ccatccgccaactcctacccggcgctgctcgcagacatcctgtgtggggccatcggctgc
atcggcttctcctgggctgcgagtccggcgtgcacggagctggagacggtgatgatggat
tggctggggaagatgctgaagctgccggaggcctttctggccgggcaagtgggagaaggg
ggcggggtgatccagggaagcgccagtgaggccactctggtggccctgctggctgctcgg
accaaagtgacccgccgcctgcaggccgcgtccccaggactgacacagggcgccatcatg
gagaagctggtggcctactcatctgatcaagcacactcctcggtggaaagagctggatta
attggaggagtgaaattaaaagcgatcccttcggatggcaagtttgccatgcgcgcgtcg
gccctgcaggaggccctggagagagacaaggcggagggcctgattcctttcttcgtggtg
gccacactggggaccacgtcctgctgctcattcgacaatctgttagaagtgggtcctatc
tgtaacaaggaggacatgtggctgcatatcgatgctgcctatgcgggcagctccttcatc
tgcccggagttccggcatcttctgaacggagtagagtttgcagattcgtttaacttcaat
ccccacaaatggctgctggtgaactttgactgctctgccatgtgggtgaaaaagaggacg
gacctgataggagcctttaaactggaccctctctacctaaagcacaaccatcaggactca
gggctcatcaccgactacaggcactggcagctgcccctgggccggagattccgctccttg
aagatgtggtttgtttttaggatgtacggagtcaaggggctgcaggcctacatccgcaag
ttctcccctttgcagcacgtccggctggctcacgagtttgagcgtttggtgcaacaggat
ccccgctttgaaatctgcacggaagtcaccctggggctggtctgtttccggctaaagggt
tccaacaggctgaacgaggagctcctggaaagaatcaacagcgccaaaaaaatccacctg
gttccctgtcacctcagagacaagttcgtgctgcgctttgccatctgcgcccgcaccgtg
gaatctgcccacgtgcagctggcctggaagcacgtcgctcagctggccaccagcctcctg
gccacccccagggactag

DBGET integrated database retrieval system