KEGG   Canis familiaris (dog): 607007Help
Entry
607007            CDS       T01007                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor isoform X1
  KO
K08523  heparin-binding EGF-like growth factor
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01522  Endocrine resistance
cfa04012  ErbB signaling pathway
cfa04912  GnRH signaling pathway
cfa04915  Estrogen signaling pathway
cfa04928  Parathyroid hormone synthesis, secretion and action
cfa05205  Proteoglycans in cancer
cfa05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    607007 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    607007 (HBEGF)
   04915 Estrogen signaling pathway
    607007 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    607007 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    607007 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    607007 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    607007 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    607007 (HBEGF)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   607007 (HBEGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF
Motif
Other DBs
NCBI-GeneID: 607007
NCBI-ProteinID: XP_005617333
Ensembl: ENSCAFG00000005749
VGNC: 41609
Position
2
AA seq 211 aa AA seqDB search
MKLLRSVVLKLFLAAVLSASVTGESLGRLRRGLAAGTGNPDSPTESTDRLLPPEGGRARE
VLDLEETDLDLLRAAAFSSKPQALATPSKEERGKKKKKGKGLGRKRDPCLRKYKDFCIHG
ECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIV
GLLMFRNLQGDCYLREDTADHRLCRGKGRHS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctgcggtcagtggtgctgaagctctttctggctgcagtgctctcggcgtcg
gtgactggcgagagcttggggcgtcttcggagagggctggcggccggaactggcaacccg
gactctcccaccgaatccacggaccggctgctgcccccggaaggcggccgggccagggaa
gtcctggacttagaagagacggacctggaccttttaagagcagctgctttctcctccaag
ccacaggctctggccacacccagtaaggaggaacgtgggaaaaaaaagaagaaaggcaaa
ggcttagggaggaagagagacccgtgtcttcggaaatacaaggacttctgcatccatgga
gaatgcaaatatgtgaaggagctccgggctccatcctgcatctgccaccccggttaccat
ggagagaggtgccatgggctgagccttccagtagaaaatcgcttatatacttacgaccat
acaaccatcttggctgtggtggctgtggtgctgtcatctgtctgtctgcttgtcatcgtg
gggcttctcatgtttaggaatctgcagggggactgctacctccgagaagatacagctgat
catagactctgcagagggaaaggacgtcacagctag

DBGET integrated database retrieval system