KEGG   Canis lupus familiaris (dog): 607443
Entry
607443            CDS       T01007                                 

Gene name
INPP5E
Definition
(RefSeq) 72 kDa inositol polyphosphate 5-phosphatase isoform X1
  KO
K20278  inositol polyphosphate 5-phosphatase INPP5E [EC:3.1.3.36]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00562  Inositol phosphate metabolism
cfa01100  Metabolic pathways
cfa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    607443 (INPP5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    607443 (INPP5E)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     607443 (INPP5E)
SSDB
Motif
Pfam: Exo_endo_phos
Other DBs
NCBI-GeneID: 607443
NCBI-ProteinID: XP_005625165
Ensembl: ENSCAFG00000019664
VGNC: 42033
Position
9
AA seq 613 aa
MLKGQLPSTGKDVAPHLGPPPTNHGQDPERTPVLPLTFPAQISNEDPEAKAKPFTPKPPP
QPRLERALSLDEKAWRRRRFRTSPEDLAAGSGAGGSRGSLQDEVPRPPGPPGSPPCLSTS
LQEIPTSRRAQDSAGGSPSSWGHCISGMISTSLDLLHRDGAVAGTSVRLPPVDPKVAPES
LRPTHRVDSGPVDGKPHLQSRLFRAHSSLGPGRPPSPLVCEARSSFSLLAPIRAKDVRSR
SYLEGSLLASGALMGAEELARYFPDRNLALFVATWNMQGQKELPPNLDELLLPAEADYAQ
DLYVIGVQEGCSDRREWETRLQETLGPRYVTLYSVAHGALYMSVLIRRDLIWFCSEVESS
TVTTRIVSHIKTKGALGVSFTFFGTSFLFITSHFTSGDGKVSERLLDYSRTIQGLALPKS
VPDTSPYRSDAADVTTRFDGVFWFGDFNFRLSGGRVAVEAILKQDLVEKVSTLLQHDQLT
QEMKKGSIFKGFQEPDIHFLPSYKFDIGKDSYDTTSKQRTPSYTDRVMYRSRHKGDICPV
RYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLIGIKRRISKEIQRQQA
LKNQHSSTICTVS
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgctcaagggacagctcccaagcacaggcaaagacgtcgccccccacctggggcccccg
cctaccaaccacggtcaggatcccgagaggaccccggtgctccctctgacctttccggca
caaatcagcaacgaggacccagaagctaaggcaaagcccttcaccccaaagcccccgccg
cagcccaggctggagcgggctctgtcactggacgagaaagcgtggaggcggcggcgtttt
cggaccagcccggaggacctggcagcgggcagtggggccggtggctccaggggctccttg
caggacgaggtccccaggcctcccggcccccctgggtccccaccctgcttgagtacctcc
ctgcaggagatccccacatcccgccgggcccaggacagcgcaggtggcagcccctcctcg
tggggccactgtatctccggaatgatcagcacttccctggacctcctgcaccgggatggg
gccgtggctgggaccagcgtcaggctgcctcctgtggaccccaaggtggcccccgagtcc
ctgcggcccacacacagagtggactcaggtccggttgatggcaagccccacctacagagc
agactgttccgcgcccacagcagcctgggccctggccggcccccaagccccctcgtctgt
gaggccagatcctccttcagcctcctggcccccatccgcgccaaggacgtccggagcagg
agctacctcgaggggagtctcctggcaagtggggccctgatgggggcggaggaactggcc
cggtacttcccagaccgcaacctggccctcttcgtggccacctggaacatgcaaggtcag
aaggagctgcccccaaacctggatgagctcctgctgcctgctgaggctgactacgcccag
gacctgtatgtcatcggggtccaggagggctgctccgacaggcgggagtgggagacgcgc
ctgcaggagacgctgggtccccgctacgtcacgctgtactcggtagcccatggggcactc
tacatgtctgtgctcatccgcagggacctcatctggttctgctcagaggtggagagctcc
acggtgaccacgcgcatcgtatctcacatcaagaccaagggggccctgggcgtcagcttc
actttcttcggcacctcttttctcttcatcacatcccatttcacctctggagacgggaag
gtgagcgagaggctgctggactatagcagaaccatccagggcctggccctgcccaagagt
gtgcctgacaccagcccctaccgctccgatgctgcggatgtcaccacccggttcgatggg
gtgttctggtttggagacttcaacttccgtctgagtggtgggcgcgtggccgtggaggcc
atcctgaagcaggacctggtagagaaggtgtctactctgctccagcatgaccagctcacc
caggaaatgaagaaagggtccatcttcaagggcttccaggagccagacatccattttctt
ccatcctacaagttcgacattggtaaggactcctacgacaccacctccaagcaaaggacc
ccatcctacacggaccgggtcatgtacagaagccgccacaagggtgacatctgtccagtc
aggtattcttcctgccctggcatcaagacgtctgaccaccgccccgtgtacggcctgttc
cgggtcaaagtgaggccggggagagacaacatcccgctagctgctggcaagtttgaccga
gagctgtacttgataggaatcaaaagacggatttccaaagaaatccagagacagcaagca
ctgaaaaatcagcactcgagtacgatttgtaccgtgtcttga

DBGET integrated database retrieval system