KEGG   Canis familiaris (dog): 607537
Entry
607537            CDS       T01007                                 

Gene name
AKR1B1
Definition
(RefSeq) aldose reductase
  KO
K00011  aldehyde reductase [EC:1.1.1.21]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00040  Pentose and glucuronate interconversions
cfa00051  Fructose and mannose metabolism
cfa00052  Galactose metabolism
cfa00561  Glycerolipid metabolism
cfa00790  Folate biosynthesis
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    607537 (AKR1B1)
   00051 Fructose and mannose metabolism
    607537 (AKR1B1)
   00052 Galactose metabolism
    607537 (AKR1B1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    607537 (AKR1B1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    607537 (AKR1B1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldose reductase
     607537 (AKR1B1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 607537
NCBI-ProteinID: NP_001239345
Ensembl: ENSCAFG00000001290
UniProt: F1PNB8
Position
14
AA seq 316 aa
MASHLVLCNGAKMPVLGLGTWKSPPGKVTDAVKVAIDLGYRHIDCAHVYQNENEVGLAIQ
EKLKEQVVKREDLFVVSKLWCTYHEKSMVKGACQKTLSDLKLDYLDLYLIHWPTGFKAGK
EYFPLDGEGNVIPSDTSFVDTWEAMEQLVDEGLVKAIGVSNFNHLQIEKILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQAKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFQVFDFELSSVDMTTLLSYNRNWRVCA
LVSCASHKDYPFTEEF
NT seq 951 nt   +upstreamnt  +downstreamnt
atggccagccacctcgtgctctgcaacggcgccaagatgcccgtcttggggctgggcacc
tggaagtcccctcccggcaaagtgaccgatgctgtgaaggtcgcgatcgaccttgggtac
cgccacatcgactgcgctcacgtgtaccagaatgagaatgaggtgggcttggccatccag
gagaagctcaaggagcaggtggtgaagcgtgaggacctcttcgtcgtcagcaagctgtgg
tgtacataccacgagaagagcatggtgaagggggcctgccagaagacgctcagcgacctg
aagctcgactacctggacctctaccttattcactggcccacaggcttcaaggccgggaag
gaatatttcccactggatggggaaggcaatgtgattcccagtgataccagttttgtggac
acgtgggaggccatggaacagctggtggatgaagggctggtgaaagccatcggagtctcc
aacttcaaccatctccaaattgagaagatcttaaacaaacctggcttaaaatataagcct
gctgttaaccagatcgagtgccacccgtacctcactcaggagaagttaatccagtactgc
caagccaaaggcatcgtggtgaccgcctatagtccccttggctcccccgacaggccctgg
gccaagcctgaggacccttccctgttggaggatccccggatcaaagcgatcgcagccaag
cacaataaaactacagcccaggtactgatccggttccccatgcagaggaatttggtcgtg
attcccaagtccgtgacacccgaacgcattgctgagaactttcaggtctttgactttgag
ctgagtagtgtggacatgaccaccttactcagctacaaccggaactggagggtctgtgcc
ttggtgagctgtgcctcccacaaggactatccattcactgaggagttctga

DBGET integrated database retrieval system