KEGG   Canis familiaris (dog): 607649
Entry
607649            CDS       T01007                                 

Gene name
KCNH4
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 4 isoform X1
  KO
K04907  potassium voltage-gated channel Eag-related subfamily H member 4
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    607649 (KCNH4)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   607649 (KCNH4)
SSDB
Motif
Pfam: Ion_trans PAS_9 Ion_trans_2 PAS_3 PAS PAS_4 cNMP_binding SlyX K-box UBM Dynamitin DUF4094 DUF4618 DUF5798
Other DBs
NCBI-GeneID: 607649
NCBI-ProteinID: XP_005624523
Ensembl: ENSCAFG00000015621
VGNC: 42249
UniProt: F6XRV4
Position
9
AA seq 1017 aa
MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEV
MQKTCSCRFLYGPETSEPALQRLHKALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEM
GEVVLFLFSFKDITQSGGPGLGSPGGHGDSNHENSLGRRGASSRLRSARRQSRTVLHRLT
GHFGRRRQGGMKTNNNVFEPKPSVPEYKVASVGGSRCLLLHYSVPKAVWDGLILLATFYV
AVTVPYNVCFLGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVVSAPRSI
GLHYLATWFFVDLIAALPFDLLYVFNITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAV
VLTLLMSVFALLAHWMACIWYVIGRREMEANDPLLWDIGWLHELGKRLEEPYVNGSAGGP
SRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQR
MYSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLESFQTTWAVNSGIDANELLRDFPDELR
ADIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGS
LEVLRDNMVLAILGKGDLIGADIPEPGQEPGSGAGPSCVLKTSADVKALTYCGLQQLSSR
GLAEVLRLYPEYGAAFRAGLPRDLTFNLRQGSDTNGLGRFSRSPRLSQPRSESLGSSSDK
TLPSITEAETGVESGGGSRPRRPLLLPNLSPARPRGSLVSLLGEELPPFSVLVSSPSLSP
SPSPALAGRGHSPSPHGPPRGSAAWKLPQLLIPPLGTFGPPDLSPRIVDGIEDSGNTAEA
PTFRFSRRPEHPRPCSQAPPSGTRSSQELATEAEEMMEKVCRLNQEISRLNQEVSQLSRE
LRHIMGLLQARLGPPGHPGASARPPDPPGPQPRAPCISPCLSGPLPSLQDTTLAEVHCPA
SVGTAEMGATPSNLRPSMLSPYPSEPESLGPSPVPEASPPTPRLMRQSFRSRPDTFH
NT seq 3054 nt   +upstreamnt  +downstreamnt
atgccggtcatgaaggggttgctggccccgcaaaacacctttctggacaccatcgccacc
cgcttcgacggcacgcacagcaacttcctgctggccaatgcacagggcccacggggcttt
cccattgtctactgctctgacggattctgcgagctcacgggctacggccgcacagaggtc
atgcagaagacctgcagctgccgtttcctctacggtccagagaccagtgagccagccctg
cagaggctgcacaaggccctggaaggccatcaggagcaccgggctgaaatctgcttctac
cgaaaggatggctcggccttttggtgcctcttggacatgatgcccatcaagaatgagatg
ggagaagtcgtgcttttcctcttttccttcaaggacatcactcagagtggaggcccagga
cttgggtccccaggaggccatggggacagtaatcatgaaaactcccttggtaggagggga
gccagctcgagacttcgatctgcccggaggcagagccgtactgtcttacaccggctgact
ggccactttggccgccggcgccagggaggcatgaaaaccaataataacgtgtttgagcca
aagccatcagtgcccgagtacaaggtggcctccgtgggggggtcccgctgcctcctcctc
cactacagcgtccccaaggccgtgtgggacggcctcatcctccttgccaccttctacgtt
gcggtcaccgtcccctacaatgtctgcttcttgggcgatgatgatacccccatcacttcg
cgacacacccttgtcagcgacatcgccgtggagatgctcttcatcctggatatcatcctg
aacttccgcaccacctatgtgtcccagtccggccaggtggtctctgctcctcgttccatt
ggccttcactacctggccacctggttctttgttgaccttattgctgctctaccttttgac
ctgctttatgtcttcaacatcaccgtgacttcactggtgcacctgctgaagacggtgcgg
ctgctgcggctgctgcggctgctgcagaagctggagcggtactcccagtgcagcgctgtg
gtgctcacgctgcttatgtccgtctttgcactcctcgcccactggatggcctgcatctgg
tacgtcatcgggcgccgggagatggaggccaatgacccgctgctttgggacatcggctgg
ttgcacgaactgggcaagcggctggaggagccctacgtcaatggctcggcgggcggcccg
tcgcggcgcagcgcctacatcgctgccctctacttcacgctgagcagcctcaccagcgtg
ggcttcggcaacgtgtgcgccaacaccgacgcggagaagatcttctccatctgcaccatg
ctcataggcgcgctcatgcacgccgtggtgttcgggaacgtgacggccatcatccagcgc
atgtactcgcgccgctcgctctaccacagccgcatgaaggacctcaaggacttcatccgg
gtgcaccgcctgccgcggccgctcaagcagcgcatgctcgagtccttccagaccacgtgg
gccgtcaacagcggcatcgacgccaacgagttactgcgtgacttcccagacgagctgaga
gctgacatcgctatgcacctgaaccgggagatcctgcagctgccgctgttcggagcggcg
agcaggggctgcctgcgggccctctccctgcacatcaagacctcgttctgcgctccaggc
gagtacctgttgcgccgtggggacgcactgcaggcacattactacgtctgctccggctcg
cttgaagtgcttcgagacaacatggtgctggccatcctggggaagggggacctgattggg
gcagatatccctgagccggggcaggagcctgggtcaggggcaggcccaagctgcgtgctg
aagaccagcgctgacgtgaaggcactgacctactgtggcctgcagcagctgagcagccga
gggctggctgaggtcctgaggctctatcctgagtacggggctgccttccgggctggcctg
ccccgggacctcaccttcaacctgcgccagggctctgacaccaatggcctcggccgcttt
tcccggtctcctcgcctctcccagccccgctcggaaagccttggctcctcctcagacaag
accctgccatccatcacggaggctgagactggggtggagtctgggggtggttctaggccc
cgccggcccctcctgctgcccaacctcagcccagcacgaccccggggctccctggtcagc
ctcttgggcgaggagctgcccccattctcagtccttgtctcatccccttccctgtcccca
tccccttcccctgccttggctggccggggccacagcccctcgcctcatggcccccccagg
ggctctgctgcctggaagctcccccagcttctcattcccccactgggaacctttggacct
ccggacctcagtccccggatagtggatggcattgaggactcgggcaacacagcagaggcc
cctacattccggttcagcaggaggcctgagcaccctaggccctgctcacaggcccctcct
tcagggaccaggtccagccaggaactggccactgaggctgaggagatgatggagaaggtc
tgcaggctgaaccaggagatctcccgtctcaaccaggaagtgtctcaactgagccgggag
cttcgacatatcatgggcctgctacaggccaggctgggtcccccaggccacccaggagcc
tcagctcggcccccagaccctcctggtccccagccaagggctccgtgcatctctccctgt
ctatctggaccactgcctagcctccaggatactactctcgctgaggtccactgcccggcc
agtgtggggacagcagagatgggggccaccccctccaacctgagaccctccatgctgtcc
ccctacccctcagagcctgagtctctgggaccctccccagtgccagaggcctcacctccg
accccacgcctcatgcggcagagctttcggtccaggccagacacgttccactga

DBGET integrated database retrieval system