KEGG   Canis familiaris (dog): 607683Help
Entry
607683            CDS       T01007                                 

Gene name
CUL4A
Definition
(RefSeq) cullin-4A
  KO
K10609  cullin 4
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03420  Nucleotide excision repair
cfa04120  Ubiquitin mediated proteolysis
cfa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    607683 (CUL4A)
  09124 Replication and repair
   03420 Nucleotide excision repair
    607683 (CUL4A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    607683 (CUL4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cfa04121]
    607683 (CUL4A)
   03400 DNA repair and recombination proteins [BR:cfa03400]
    607683 (CUL4A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    607683 (CUL4A)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     607683 (CUL4A)
DNA repair and recombination proteins [BR:cfa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      607683 (CUL4A)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      607683 (CUL4A)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   607683 (CUL4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW
Motif
Other DBs
NCBI-GeneID: 607683
NCBI-ProteinID: XP_849542
Ensembl: ENSCAFG00000006290
VGNC: 39731
UniProt: F1Q284
Position
22
AA seq 761 aa AA seqDB search
MADETPRKGALSALVGHTNGLTKPASLAAAAVASKPGGAGGSKKLVIKNFRDRPRLPDNY
TQDTWQKLHEAVRAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYKQLRQVCEDHVQAQI
LQFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELF
RNHIISDKMVQSKSIDGILLLIERERNGEAVDRSLLRSLLSMLSDLQVYKDSFELKFLEE
TNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEH
LTAILHKGLDHLLDENRVPDLTQMYQLFSRVKGGQQILLQHWSEYIKTFGTTIVINPEKD
KDMVQDLLDFKDRVDHVIEVCFQRNEKFINLMKESFETFINKRPNKPAELIAKHVDSKLR
AGNKEATDEELERILDKVMIIFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSK
LKHECGAAFTSKLEGMFKDMELSKDIMVQFKQYMQNQSDPGSIDLTVNILTMGYWPTYTP
MEVHLTPEMIKLQEVFKTFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLV
LLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLVKSPKGKEVEDGDTFMFNG
EFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSE
LYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgagacccccaggaagggcgccctgtcggcgctggtcgggcacaccaacggc
ctcaccaagcccgcgtccctggccgcggccgccgtggcctccaagccgggcggcgccggc
ggctccaagaagctcgtcatcaagaatttccgagacagaccgcggctgccggacaactac
actcaggacacctggcagaagctccacgaggcggtgcgagccatccagagcagcacgtcc
atcaggtacaacctggaggagctgtaccaggctgttgaaaatctctgttctcacaaagtt
tccccaacactctacaaacagctgcgccaggtctgtgaagatcatgtccaagcacagatc
cttcagttcagagaagactcactagatagtgttttatttttaaagaagattaacacatgc
tggcaagatcattgcagacaaatgatcatgatcagaagtattttcctgtttttggatcgc
acttacgtacttcagaattccatgcttccttctatctgggatatgggattggaacttttt
agaaaccatatcattagtgataaaatggttcaaagcaaaagcattgacggaattctgcta
ttaattgaacgagaaagaaatggtgaagcagtggatcgtagtttattgagaagtctgctg
agtatgctgtccgaccttcaggtatataaagattcatttgaactgaagtttttggaagaa
actaattgtttatatgctgcagaaggccagagattaatgcaagaaagagaggttccagaa
tatcttaaccatgtaagtaagcgtttagaggaagaaggagaccgagtaatcacgtattta
gaccacagcacacagaaaccactgattgcttgtgtggagaagcagctattaggagaacat
ttaacagcaattcttcacaaagggcttgaccacctgcttgatgagaacagagtgcccgac
ctcactcagatgtaccagctattcagccgtgtgaagggtgggcagcagatcctgctgcag
cactggagcgagtacattaagacttttgggacaacaattgttatcaatcctgaaaaagac
aaagatatggtacaagatctgctggattttaaagatcgggtggaccatgtgatagaagtg
tgcttccagaggaacgagaagttcatcaacttgatgaaggaatcctttgaaacgtttatc
aacaagaggccaaataaacccgcagagctgatagcaaagcatgttgattcaaaattgaga
gcgggtaataaagaagcaacagacgaagagctggaaaggattcttgacaaggtcatgata
atattcaggttcattcacgggaaagatgtctttgaagcattttataaaaaagatttggca
aaaagactccttgttggaaaaagcgcctcagttgatgctgaaaaatctatgttgtcaaaa
ctaaagcatgaatgcggcgctgctttcaccagcaagctggaaggcatgttcaaggacatg
gaactctccaaggacataatggtccagttcaagcagtatatgcagaatcaaagtgaccca
ggctctatagatctaacagtgaatatacttacgatgggatactggccaacctacacacca
atggaagtgcatttaaccccggaaatgattaaacttcaggaagtatttaagacattttat
ctcggaaagcacagtggtcggaaacttcaatggcaaactacattggggcatgctgtttta
aaagcagagtttaaggaaggaaagaaggagttccaggtgtcccttttccagacactggtg
cttctcatgttcaatgaaggggatggcttcagctttgaagaaataaaaatggccacgggg
atagaggacagtgagctgcgaaggacattacaatccctggcctgtggcaaagcacgagtt
ctggttaaaagtcccaaagggaaggaggtggaagatggagacacgttcatgttcaacgga
gagttcaagcacaagttgtttcggataaagatcaaccagatccagatgaaggaaactgtt
gaggaacaagtcagcaccacggaacgagtgtttcaggacagacagtatcagattgacgct
gctattgtcaggataatgaagatgagaaagactcttggtcataatcttctagtttctgaa
ttgtataatcagctgaaatttccagtcaagcctggagatttgaaaaagagaattgaatcc
ctcatagacagagactatatggagagagacaaggacaatccaaatcagtaccactacgtg
gcctga

DBGET integrated database retrieval system