KEGG   Canis familiaris (dog): 607841Help
Entry
607841            CDS       T01007                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP3-like
  KO
K09570  FK506-binding protein 3 [EC:5.2.1.8]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cfa03110]
    607841
Enzymes [BR:cfa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     607841
Chaperones and folding catalysts [BR:cfa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    607841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTHB FKBP_C
Motif
Other DBs
NCBI-GeneID: 607841
NCBI-ProteinID: XP_849864
Position
11
AA seq 225 aa AA seqDB search
MVVAVPQQAWTMEQLHSEQLPKKDIIKFLQDHGSDLFLAECKLLGNIKNVAKTANKGHLV
TAYNHLFESKRFKGTESISKVSEQVKNVKLNEDKPKETKCEETLDEGPPKYTKSVLKKGD
KTNFPKKGDVVHCWYTGTLQPGIPVFDTNIQTISKKKKNAKPLSFKVEIGKVIRGWDEAL
LTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLIFEVELVDID
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggccgttccacagcaggcctggaccatggagcagctgcacagtgagcaacta
cccaagaaggacattatcaagtttctacaggaccatggttcagatttgtttcttgcagaa
tgtaagttattaggaaacattaaaaatgtggccaagacagctaacaagggccatttggtt
acagcctacaaccatctttttgaaagtaagcgtttcaaaggtactgaaagtataagtaaa
gtgtctgagcaggtgaaaaacgtgaagcttaatgaagataaacccaaagaaaccaagtgt
gaagagactctggatgagggtccaccaaaatatacaaaatctgtccttaaaaagggagat
aaaaccaactttcccaaaaagggagatgttgttcactgctggtatacaggaacactacag
ccagggatccctgtttttgatactaatattcaaaccatctcaaagaagaagaaaaatgcc
aagcctttaagttttaaggttgaaataggcaaagttatccgaggatgggatgaagcactc
ttaactatgagtaaaggagaaaaggctcgactagagattgaaccagaatgggcttatgga
aagaaaggacagcctgatgccaaaattccaccaaatgcaaaactcatttttgaagtggaa
ttagtagatattgattga

DBGET integrated database retrieval system