KEGG   Canis familiaris (dog): 607878Help
Entry
607878            CDS       T01007                                 

Gene name
PIN4
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cfa03110]
    607878 (PIN4)
Enzymes [BR:cfa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     607878 (PIN4)
Chaperones and folding catalysts [BR:cfa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    607878 (PIN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase
Motif
Other DBs
NCBI-GeneID: 607878
NCBI-ProteinID: XP_022272117
Position
X
AA seq 175 aa AA seqDB search
KQKTQRRSFPPLLYLWFHHHPHNRPNFLLVSQLHPHCCEGPRTRSALDYACFQGRSEDGG
AASGSDSSDKKAQGPKGGGNTIKVRHILCEKHGKIMEAMEKLKSGMRFNEVATQYSEDKA
RQGGDLGWMTRGSMVGPFQEAAFALPVSGPDEPVFTDPPIRTEFGYHIIMVEGRK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
aaacaaaaaacgcaaaggcggagtttcccgcccctgctctacctttggttccaccaccac
ccccacaaccgaccaaacttcctattggtcagccagcttcatccccactgttgcgagggc
ccaaggacccggtctgccctagattatgcctgcttccagggccgcagcgaagacggggga
gccgcctccgggagtgacagttctgacaaaaaggcccagggtcccaaaggtggtggtaat
acaataaaggttagacacattctgtgtgaaaaacatgggaaaatcatggaagccatggaa
aagttaaagtctggaatgagattcaatgaagtggccacacagtatagtgaagataaagcc
aggcaagggggcgacttgggttggatgaccagaggttccatggtgggaccatttcaagaa
gcagcatttgccttgcctgtaagtgggccagatgagcctgtgtttaccgaccctccaatt
aggacagaatttggatatcatattattatggttgaagggagaaaataa

DBGET integrated database retrieval system