KEGG   Canis familiaris (dog): 607879Help
Entry
607879            CDS       T01007                                 

Gene name
ESPL1
Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04110  Cell cycle
cfa04114  Oocyte meiosis
cfa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    607879 (ESPL1)
   04114 Oocyte meiosis
    607879 (ESPL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    607879 (ESPL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfa01002]
    607879 (ESPL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    607879 (ESPL1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     607879 (ESPL1)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C50: separase family
   607879 (ESPL1)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    607879 (ESPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 607879
NCBI-ProteinID: XP_005636831
Ensembl: ENSCAFG00000007030
VGNC: 40475
UniProt: E2RBD6
Position
27
AA seq 2108 aa AA seqDB search
MRSFKGIDFGTLLSNPKEAEELLPDLKEFLSKLPAGSPSCRSDAERRRACDAILRACNQQ
LTARLACPRHLESLLDLAELACDGYVVFTPQRSPLYLERILFIFLRNIATQGIPEATLRF
AQPLHACLVQCSRQAAPQDYEAVARGSFSLLWKAAEGLEDQRAAFSARLKALSFLVLLED
ESTPCEVPYFASPTAYRVAVAHQLFDATGHDLNEADADFLDDLLSRHVIKALVGEGGGPP
GPLSPQRALCLLELTLEHCRRLCWSCHHAKATRVVEKAHKYLRDTDLAPSLQLCQLVVEL
LQTGEGEPQALAKLLITASTILNNSVEAPSPPLRALCDSCQFFLSALERGIKRRYGPDAV
LGLFAFLRGYYSLIRQLQDSVGGDSSKQRQSLIQMQFQGLHLYTVVVYDFAQGCQVAQVA
DLAQLVESCKSTVAWMLEVLQSLSGQELTDYLGMTASYTSNLAYSFYSHKLYAEACAISE
PLCQHLGLAKLGTYPELPPEKLHRCFRLHGESLKKLGKQAEGCTMVTLWLAALRPCGPQH
MAEPVTFWVRVKMDAARAGDKELQLRTLRDSLSAWDPETLVFLLREELQAYKAVRADTGQ
ERFNVICDLLELSPEETPAGAWARATHLVELAQVLCYHDFAQQTNCSALDAIQEALQLLE
SVRPETQAQDQLLDDKAQALLWLYICTLEAKMQEGIERDRRAQAPNNLEEFEVNDLNYED
KLQEDRFLYSNIAFNLAADAAQSKCLDQALALWKEVLTKAQAPAVRCLQQTLASLQTLAA
LYQLAAKPLQALEVLQLVRIVSQRLEDHAKAAGSSCHTTQLLLTLGCPSYAQLHLEKADA
SLKLLDHTTDTYLLLSLTCDLLRSHLYCVHQKVPEGAALLLSVLRDPALQRPSKAWYLLR
VQALQLVACYLGLSSHSLPAPLREQLCTQGWQTPEIALIDSHKLLRSIILLLMGSDVLST
QKAAVETPFLDSGENLVQKWQVLTEVLSCSETLVSRLGQLGSVSEAKAFCLEALKLTTKL
QMPRQCALFLVLKAELELARNDLDLCQSDLQQVLFLLESCTDFGGLAQPLDSVKKVHLQK
GKQQAQAHRPPELPEEEPFLRGPALELVATVAKEPGPVVPSTNSSPILKVRTPPSAGFLT
HLPTCDCLLCASPVLSAVCLRWALVTARVRLATGHQAQGLDLLQAVLNGCPAATERLTQA
LQASLNHKAPLSPVPRLLDEILAQAYTQLALEGLSRPSNKSLGKVLQSALRFVAAQAPHL
EPWRASLLWVRALAKLAALNCCAAQLFASSWGWQPPSVKSPPGSEPSKPRSQKHSGREHQ
QAASCTPSLRNTSLKGPEGGGLPCTPKPRGQARQAGPRVPFTVFEEVLSTKSKPEVPKAP
RVQQRVQTRLKVNFSDDSDLEDRVSVEAQLAEGPKRRGTASQGRGRARKGSGLKTVSVAA
PASAPRRPGLSGRSQRAKKVTPGHREELGPEIMRTIPAEEMTDDQMELSFEILRGSDGED
STLDGKAPAPGPDTAIGECEVLRRDSSKEELPIPRPDKERDKDFGPRLRLPSAPTAIGVS
TLDSICDLLTVAFRGVSHCPPSGLYAHLCRILALCLGHRDPCATACLVTESVSITCRHQL
LTHLHRQLSKAQKHRGSLEMAEELQRLSLEEKPRDVPLARIQHLFSFGASGSGQFPEPEK
ESFQERLALIPRGVTVCVLALATLQPGTVGNTLLLTRLEKDNPPVTVQIPTAQSKLPLSA
ALKEFDAIQKEQKENSNCTDKREWWTGRLELDHRMEALITSLEKHVLGCWRGLLLPSSDD
PGPAQEASRLQELLQECGWKYPDPTLLKIMLHSARTLAPEDIQTLAYGLCPAQPERAQEL
LSEAVGRLQGQTVPSNRHLVLVLDKDLQKLPWESMPSLRALSVTRLPSFRFLLSYSIIKE
SGASSVLSQGVDPRNTFYVLNPHNNLSSTEEQFRANFSSEAGWKGVVGERPSPEQIQAAL
TEHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVHGSLEGAGIVLKYIMA
GCPLFLGNLWDVTDRDIDRYTEALLQGWLRAGPGAPLLYYVNQARQAPRLKHLIGAAPVA
YGLPVCLR
NT seq 6327 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcttcaaaggaatcgacttcgggaccttgctaagcaacccaaaggaggctgaa
gaattgctgcctgacttgaaggagttcctgtccaagcttccagctggttcacccagctgc
cgatctgatgccgagaggagacgagcatgtgatgccatcttgagggcttgcaaccagcag
ctgacagccaggctggcttgccctaggcacctggagagtctgctggacctggcagagctg
gcttgcgatggctacgtggtgttcaccccccagcgctcacccctctacctggaacgaatt
ctcttcatctttcttcggaacattgccacacagggaatcccagaggccacacttcgattc
gcgcagcccctccatgcctgtttggtgcagtgctctcgccaagctgctccccaggactat
gaggctgtggcccgcggcagcttttctctgctttggaaggcggcagaaggcctggaggat
cagcgggctgcattctcggctcggctgaaggccttgagttttctggtgctcttggaggat
gaaagtaccccttgtgaggttccctactttgcttctccaacagcctatcgagtggcagtt
gcccatcagctatttgatgccactgggcatgatctgaatgaagcagatgctgatttccta
gatgacctgctctccaggcatgtgatcaaagccttggtgggtgagggagggggtcctcct
ggtcctctctctccccagagggccctctgtctcttggaactcaccctggaacactgccgt
cgcctctgctggagctgccaccatgccaaggctaccagggtagtggagaaggcccacaaa
tacctaagggacaccgatttggcccccagcctccagttatgccagcttgtggttgaactg
ctacagaccggggagggagaacctcaggctctggccaagcttctgatcacggcatcaact
atcctgaacaacagcgtggaggccccatcaccccctctgcgggcattgtgtgacagctgc
cagttcttcctctcagccctggagcgaggcatcaagaggcgctatggacctgatgctgtt
ctgggcctctttgcttttctcaggggctactattctctcatccggcagctgcaggacagt
gtcggtggggactcctccaagcagcggcagtctttaatccagatgcagtttcagggactt
catctctacactgtagtggtttatgactttgcgcaaggctgtcaggtagctcaagtggct
gacctggcccagctagtggaaagttgcaaatctactgtggcctggatgctggaggtctta
cagagcctgtcaggccaagagctgactgactacctgggcatgactgcctcctacaccagt
aacttggcctacagcttctatagtcacaagctgtacgccgaggcctgtgccatctctgag
cccctctgtcagcacctgggcttggcgaagctgggcacctatcctgagttgcctcctgag
aagttgcacagatgcttccggctgcacggagagagtttgaagaaactgggtaagcaggcc
gagggctgcacgatggtgactttgtggctggcggccctgcggccctgtggcccccagcac
atggctgagccagtcaccttctgggttcgggtcaagatggatgcagccagagcaggagac
aaggagctacagctgaggaccctgcgagacagcctgagtgcctgggacccggagaccctg
gtcttcctgctgagggaagagctgcaggcctataaggctgtgcgagcggacacggggcag
gagcggttcaacgtcatctgtgacctgttggaactgagccctgaggagacaccggctggg
gcctgggctcgagccacccacctggtggaactggctcaggtgctctgctaccacgacttt
gcccagcagaccaactgctctgccctggatgctatccaggaagccctgcagcttctagag
tctgtgaggcccgagacccaggcccaggatcagcttctagatgataaagcacaggccctg
ctgtggctctacatctgcactctggaggccaagatgcaggagggtatcgagcgggatcgg
agagcccaggcccctaataacctggaggaatttgaagtcaatgacctgaactatgaagat
aaactgcaggaagaccgcttcctgtacagtaacatcgccttcaacctcgctgcagatgct
gctcagtccaaatgcctggaccaagccctggccctgtggaaggaggtgcttacgaaggca
caggcgcctgctgtccgttgtctccagcagacactggcctctctgcagaccctagcagcc
ctctatcagctggcggcaaagcccctgcaggccctggaggtcctccagcttgttcggatc
gtctcccagaggttggaagatcacgcaaaggcagctggctcctcctgccacactacccag
ctgctcctgacgctcggctgtcccagctatgcccagctgcacctggaaaaggcagacgcc
agcctgaagcttctggatcacaccactgacacgtacttgctcctttcgctgacctgtgac
ctgcttcgaagtcacctctactgtgttcaccagaaggtgcccgagggcgccgctctgctg
ctgtccgtgctgcgggaccccgccctccagcggccgtccaaggcctggtatctgctgcgt
gtccaggccctgcagctggtggcctgctacctcggcctctcgtcacacagcctgccggcc
cccctgcgggagcagctctgcacccaaggctggcagacacccgagattgcactcatcgac
tcgcataagctcctccgaagcatcatcctcctgcttatgggcagcgacgtgctctcgacg
cagaaggcagctgtggagaccccgttcctggactccggggaaaatctggttcagaagtgg
caggttctgaccgaggtgctgagctgctcagagacgctggtctcccgcctgggccagctg
ggcagcgtgagcgaagccaaggccttttgcttggaggccctgaaactcacgacgaagctg
cagatgccacgccagtgcgccctgttcctggtgctgaaggcggagctggagctggcacgc
aacgacctcgacctctgccagtcggacctgcagcaggttctgttcttgctggagtcttgc
acagactttgggggactagcccagcccctggactctgtgaagaaggtgcacctgcagaag
ggcaagcagcaggcccaggcacaccgtcctccggagcttccagaagaggagcccttcctc
agaggccctgctctggagctggtagccactgtggccaaggagcctggccccgtagtgcct
tctactaactcttcccctatcctgaaggtgaggaccccgcccagcgccggcttcctgacc
cacctgcccacgtgtgactgcctcctctgtgccagccctgtcctctcggcagtctgtctg
cgctgggcattggtcaccgcgagggtgcggctggccacgggccatcaggcccagggtctg
gatctgctgcaggccgtgctgaacggatgccctgcagccaccgagcgcctcacccaagct
ctgcaggcttccctgaatcacaaagcacccctgtcccctgtcccgaggcttctggatgag
atcctggctcaggcctacacacagctggcactggaggggctgagccgcccgtcaaacaag
agcctggggaaggtcctgcagtcagcgctgaggtttgtggcagcgcaggctccccacctg
gagccttggcgagccagcctgctctgggttcgggccctggcaaagctggctgccctcaac
tgttgcgcggcccaactttttgcaagctcctggggctggcagcccccgtccgtgaaatcg
cccccaggctcagagccgtctaagcctcggagtcaaaaacattctggaagagagcatcaa
caggcagcctcttgcaccccgtccctccgtaacacctctctgaaaggtccggaaggtgga
ggactgccctgcacacctaagccccggggccaggccaggcaggcaggccctcgtgtccct
ttcaccgtgtttgaggaagtcctctctacaaagagcaagcctgaggttcccaaggccccc
agggtacaacagagggtccagacgcgactcaaggtgaacttcagcgatgacagtgacttg
gaagaccgggtctcagttgaggcacagcttgcagaggggcccaagagacggggcactgct
tcccagggccggggccgggccaggaagggctcgggcttgaagactgtttcagtggcagcc
ccagctagtgccccccggcgccctggcctcagtggcaggagccagagggccaagaaggtg
acaccagggcaccgtgaagagctgggccctgagatcatgaggaccatccccgcggaggaa
atgactgacgaccagatggaactgagctttgagatccttaggggctctgatggagaagac
tctaccttagatgggaaggcacccgctccaggacctgacacggccataggcgaatgtgag
gtgttgagacgtgattccagcaaagaggagctgcccatcccacgcccagacaaggagaga
gacaaggacttcggtcctcggctccggctcccctcagcccctacagccattggtgtgtcc
accctggattccatctgtgacttgctgaccgttgctttccgtggggtgagtcactgccct
ccgagtgggctctatgctcatctctgccgcatcctggctttgtgcttggggcaccgggat
ccctgtgccactgcctgcctcgtcaccgagtctgtgtccatcacctgtcgccaccaactg
ctcacccacctccacaggcagctcagcaaggcccagaagcaccggggatcactcgaaatg
gcagaggagctacagaggctgagcctggaggagaagcctagagatgtccccctggcccgc
atccagcacctcttttccttcggggcttcgggttccggtcaattccctgagcccgagaag
gagagtttccaggagcgcctggcgctcatccccaggggcgtgactgtgtgtgtgttggct
ctggccacgctccagcctggaactgtgggcaacaccctgctgctgacccggctggaaaaa
gacaatcccccagtcactgtgcagatccccactgcccagagcaagcttcctctgagcgca
gccctgaaagagttcgacgccatccagaaggaacagaaggagaacagcaactgtacagac
aaacgagaatggtggactgggcggctagaactggaccacaggatggaggctctcatcact
tccctggagaagcatgtgttgggctgctggaggggactgttgctaccatccagtgacgac
cctggccctgcacaggaggcctcccgcctacaagagttgctgcaggaatgcggctggaaa
tatcctgacccaactctgctgaaaatcatgctccatagtgccagaacccttgctcccgag
gacattcagaccctggcctatgggctgtgcccagcccagccagaacgagcccaggagctt
ctgagtgaggccgtaggacgtctgcagggtcagacggtaccaagcaacaggcaccttgtc
ttagtgctagacaaggacctgcaaaagctgccatgggagagcatgcccagcctccgggcg
ctgtccgtcactcggctgccctccttccgcttcctactcagttactccatcatcaaagag
tctggggcctcgtcagtgctaagccaaggggtggatccacgcaataccttctatgtcctg
aaccctcacaataacctgtccagcacagaggagcaatttcgagccaattttagcagtgaa
gctggctggaaaggtgtggttggggaaaggccaagcccagaacaaatacaggcggccttg
acggagcacgacttatatatctacgcagggcacggggctggggcccgcttcctggacgga
caggccgtcctccggctgagctgccgggcggtggccctgctgttcggctgcagcagcgcg
gccctggctgtccacgggagcctggagggagctggcattgtgctcaagtacatcatggcc
ggctgtcccctgtttctgggtaatctctgggatgtgactgaccgagacattgaccgctac
acggaggctctgctgcagggctggctgcgggcaggcccaggagccccgcttctgtactac
gtcaaccaggcccgccaggctccccgactcaagcatcttattggggctgcacctgtggcg
tacggcttgcccgtctgcctgcggtga

DBGET integrated database retrieval system