KEGG   Canis familiaris (dog): 608044Help
Entry
608044            CDS       T01007                                 

Gene name
CAPN9
Definition
(RefSeq) calpain-9
  KO
K08578  calpain-9 [EC:3.4.22.-]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cfa01002]
    608044 (CAPN9)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     608044 (CAPN9)
Peptidases and inhibitors [BR:cfa01002]
 Cysteine peptidases
  Family C2: calpain family
   608044 (CAPN9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 608044
NCBI-ProteinID: XP_850025
Ensembl: ENSCAFG00000012047
VGNC: 38708
UniProt: E2RSU5
Position
4
AA seq 692 aa AA seqDB search
MPYLYRAPGPQKHPVPKDARITHSSGQSFEQLRQECVQKGILFEDPDFPANSSSLFYSER
PQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNEKALARVVPQD
QSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLIFLHSADHSEFWSALLEKAYAKL
NGSYEALKGGSTIEAMEDFTGGVAETFATKEAPENFYEILEKALKRGSLVGCSIDTRNAA
ESEARTPFGLIKGHAYSVTGIDQVNFRGQKMELIRVRNPWGQVEWNGSWSDSSSEWRSVG
PAEQKRLCHTALDDGEFWMAFRDFKAHFDKVEICNLTPDALEEDALHKWEVTVHQGSWVR
GSTAGGCRNFLDTFWTNPQIKLSLTEKDEGQEDCTFLVALMQKDRRKLKRFGADMLTIGY
AIYQSPSKDEHLNKDFFRYHASQARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEAD
FCLRIFSEKKAITRDMDGDVDIDLPELPKPTPAGQETEEELQFRALFDQIAGEDMEVTAE
ELEYILNAVLQKKKDFKFKKLSLISCKNIISLMDTSGNGKLEFKEFKVFWDKLKKWTNLF
HQFDTDKSGTMSSYELRTALKATGFQLGCHLLQLIVLRYADEGLQLTFDDFLNCLVRLEN
ASRVFQALSTKDKDEEFIHLNINEFINLTMNI
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgccttacctctatcgggccccagggccccagaagcacccagttcccaaggacgcccgc
atcacccactcctcaggccagagcttcgagcaactgaggcaggagtgtgtgcagaagggc
atcctgtttgaggatccagacttcccagccaacagctcctctctcttctatagcgagaga
ccccagatccccttcgtgtggaaacggccaggggaaatagtgaaaaacccagaattcatt
cttggaggggccaccaggacagatatctgccagggggagcttggcgactgctggctatta
gctgccattgcctccctcacacttaatgaaaaagctctggctagagtcgttccccaggac
caaagctttggacctggttatgccgggatattccacttccagttctggcagcacagtgaa
tggttggatgtggtcatcgatgaccggctgcccaccttcagggaccgcttgattttcctc
cactccgctgaccacagtgagttctggagtgccttgctggaaaaagcctacgccaagctg
aacggtagctatgaagctctgaaggggggcagcaccatcgaggccatggaagacttcacg
gggggtgtagcagagaccttcgcaactaaagaggctcccgagaacttctacgagattcta
gaaaaggccttgaagaggggctctctggtgggctgctccattgataccagaaatgcagca
gaatctgaagcccggacgcctttcggtctcattaagggccatgcctacagtgtgacagga
attgaccaggtaaacttccgaggccagaaaatggagctcatccgagtccggaacccttgg
ggccaggttgagtggaacgggtcctggagtgacagctcctccgagtggcgttccgttggc
ccagctgagcagaagcgcctgtgtcacacggctctggatgacggggagttctggatggca
tttagagacttcaaagcccactttgacaaagtagaaatctgcaacctcactcctgacgcc
ctggaggaggatgccctccacaagtgggaggtgaccgtccatcaaggaagctgggtgcgg
ggctccacggccgggggctgccgcaatttcctggacaccttctggaccaatccacaaata
aaattgtccctgactgagaaagatgaggggcaagaggactgcactttcctcgtggccctg
atgcagaaagatcgaaggaaactcaagaggtttggagctgacatgctgaccattggttat
gccatttaccagagccccagcaaagacgagcacctgaacaaagacttcttcaggtaccat
gcttcccaggccagaagcaaaacgttcatcaacctgagagaagtctccgaccgcttcaag
ctgccgcctggggagtacatcctgattcccagcacttttgagccccatcaggaagctgat
ttctgcctgaggatcttttcagagaagaaagccatcacccgggacatggatggagatgtg
gacattgaccttccagagcttccgaagcccactccagccggccaggagacggaggaggaa
ctgcagttccgggccctgtttgaccaaatcgctggggaggatatggaggtgacagcggag
gaactagaatatattttaaatgctgtgctgcaaaagaaaaaggacttcaaattcaagaag
ctaagcctgatttcctgtaaaaacatcatttctctaatggataccagtggcaatgggaag
ctggagttcaaggagttcaaagtgttctgggacaagctgaagaagtggacaaaccttttc
catcagttcgatacggacaagtctggcaccatgtcctcctacgagctgcggactgccctg
aaagccacaggcttccagctgggctgtcacctcctgcagctgattgtcctcaggtacgcg
gacgagggcctccagctgaccttcgatgacttcctcaactgcctggtccggctggagaat
gccagccgggtgttccaggctctcagtacgaaggacaaggacgaggagttcattcatctg
aacataaatgagttcatcaacttgacaatgaacatctga

DBGET integrated database retrieval system